Sample details: e803b92de579a41dcec0ad5fbeadbc12 --

Hashes
MD5: e803b92de579a41dcec0ad5fbeadbc12
SHA1: 5aab6cc584f473ba2c4415df3fb73b1968067778
SHA256: 3a7d2f9c9edee3eef9d7f1522520444eb6374f7e9e310164962ec296813375f4
SSDEEP: 24576:XDylMECd2JOghMCIa1+ZUAS29C5+Iha4sHlqHQfj3cP+G:m2mOm4G245DItFB3X
Details
File Type: PE32
Yara Hits
YRP/Microsoft_Visual_Cpp_v50v60_MFC | YRP/Borland | YRP/IsPE32 | YRP/IsWindowsGUI | YRP/IsPacked | YRP/IsBeyondImageSize | YRP/borland_delphi | YRP/domain | YRP/contentis_base64 | YRP/screenshot | YRP/keylogger | YRP/win_mutex | YRP/win_registry | YRP/win_files_operation | YRP/win_hook | YRP/Delphi_Random | YRP/Delphi_FormShow | YRP/Delphi_CompareCall | YRP/Delphi_Copy | YRP/Delphi_StrToInt | YRP/Delphi_DecodeDate |
Source
http://bit.do/dSws3
Strings
		This program must be run under Win32
.idata
.rdata
P.reloc
P.rsrc
Boolean
Smallint
Integer
Cardinal
Double
Currency
String
WideString
Variant
OleVariantp
TObject|
TObjectp
System
IInterface
System
TInterfacedObject
TBoundArray
System
	TDateTime
YZ]_^[
YZ]_^[
_^[YY]
YZ]_^[
~KxI[)
SOFTWARE\Borland\Delphi\RTL
FPUMaskValue
_^[YY]
YZXtm1
ZTUWVSPRTj
tVSVWU
t@h<Y@
kernel32.dll
GetLongPathNameA
Software\Borland\Locales
Software\Borland\Delphi\Locales
_^[YY]
odSelected
odGrayed
odDisabled	odChecked	odFocused	odDefault
odHotLight
odInactive	odNoAccel
odNoFocusRect
odReserved1
odReserved2
odComboBoxEdit
Windows
TOwnerDrawState
Magellan MSWHEEL
MouseZ
MSWHEEL_ROLLMSG
MSH_WHEELSUPPORT_MSG
MSH_SCROLL_LINES_MSG
	TFileName
	Exception
	Exception
SysUtils
EAbort
EHeapException
EOutOfMemory
EInOutError
	EExternal
EExternalException
	EIntError
EDivByZero
ERangeError
EIntOverflow
EMathError
EInvalidOp
EZeroDivide
	EOverflow
EUnderflow
EInvalidPointer
EInvalidCast
EConvertError
EAccessViolation
EPrivilege
EStackOverflow
	EControlC
EVariantError
EAssertionFailed
EAbstractError
EIntfCastError
EOSError
ESafecallException
SysUtils
SysUtils
TThreadLocalCounter
$TMultiReadExclusiveWriteSynchronizer
<*t"<0r=<9w9i
INFNAN
$*@@@*$@@@$ *@@* $@@($*)@-$*@@$-*@@$*-@@(*$)@-*$@@*-$@@*$-@@-* $@-$ *@* $-@$ *-@$ -*@*- $@($ *)(* $)
<'t$<"t 
<#t&<0t%<.t,<,t3<'t5<"t1<Et:<et6<;tF
<#t'<0t#<.t
<Et$<et <;tS
_^[YY]
_^[YY]
$YZ_^[
t%HtIHtm
_^[YY]
$Z]_^[
QQQQQQSVW3
QQQQQSVW
_^[YY]
	TErrorRec
TExceptRec
YZ]_^[
m/d/yy
mmmm d, yyyy
:mm:ss
DVCLAL
kernel32.dll
GetDiskFreeSpaceExA
(Z]_^[
oleaut32.dll
VariantChangeTypeEx
VarNeg
VarNot
VarAdd
VarSub
VarMul
VarDiv
VarIdiv
VarMod
VarAnd
VarXor
VarCmp
VarI4FromStr
VarR4FromStr
VarR8FromStr
VarDateFromStr
VarCyFromStr
VarBoolFromStr
VarBstrFromCy
VarBstrFromDate
VarBstrFromBool
TCustomVariantType
TCustomVariantType
Variants
TVarDataArray
Variants
TInvokeableVariantType
EVariantInvalidOpError
EVariantTypeCastError
EVariantOverflowError
EVariantInvalidArgError
EVariantBadVarTypeError,
EVariantBadIndexError
EVariantArrayLockedError
EVariantArrayCreateError
EVariantNotImplError
EVariantOutOfMemoryError
EVariantUnexpectedError
EVariantDispatchError
EVariantInvalidNullOpError
_^[YY]
QQQQSV
QQQQSV
FSVWUQ
Mt0MtU
Smallint
Integer
Single
Double
Currency
OleStr
Dispatch
Boolean
Variant
Unknown
Decimal
ShortInt
LongWord
String
Array 
ByRef 
$YZ]_^[
Variants
_^[YY]
TStringDesc
Variants
t~h$xL
tagEXCEPINFO 
	EOleError
EOleSysError
EOleExceptionX
EOleRegistrationError
Apartment
Neutral
_^[YY]
ole32.dll
CoCreateInstanceEx
CoInitializeEx
CoAddRefServerProcess
CoReleaseServerProcess
CoResumeClassObjects
CoSuspendClassObjects
QQQQQQQQSV
TPublishableVariantType
EPropertyError
EPropertyConvertError
_^[YY]
TAlignment
taLeftJustify
taRightJustify
taCenter
Classes
TLeftRight
Classes
	TBiDiMode
bdLeftToRight
bdRightToLeft
bdRightToLeftNoAlign
bdRightToLeftReadingOnly
Classes
ssShift
ssCtrl
ssLeft
ssRight
ssMiddle
ssDouble
Classes
TShiftState
THelpContext
	THelpType
	htKeyword	htContext
Classes 
	TShortCut
TNotifyEvent
Sender
TObject
EStreamError
EFileStreamError
EFCreateError
EFOpenError
EFilerErrort
EReadError
EWriteError$
EClassNotFound
EResNotFound
EListError
EBitsError
EStringListError
EComponentErrorH
EOutOfResources
EInvalidOperation
TThreadList
TPersistent
TPersistent
Classes
TInterfacedPersistent@
TInterfacedPersistent
Classes
TCollectionItem
TCollectionItem
Classes
TCollection
TCollectionp
Classes
TOwnedCollection
TOwnedCollectionD
Classes
IStringsAdapter
Classes
TStrings
TStrings8
Classes
TStringItem
TStringList
TStringListh
Classes
TStream
THandleStream
TFileStream
TCustomMemoryStreamX
TMemoryStream
TResourceStream
TStreamAdapter
TClassFinder
TFiler
TReader
TWriter
EThread
TComponentName
IDesignerNotify
Classes
TComponent
TComponent
Classes
TBasicActionLink
TBasicAction
TBasicAction
Classes
TIdentMapEntry
	TRegGroup
TRegGroups
YZ]_^[
$Z]_^[
$Z]_^[
_^[YY]
	TIntConst
_^[YY]
%s[%d]
Strings
S$_^[Y]
_^[YY]
SdZ]_^[
$Z]_^[
TPropFixup
TPropIntfFixup
_^[YY]
_^[YY]
Classes
_^[YY]
_^[YY]
QQQQQQQS
_^[YY]
QQQQS3
QQQQQQQQS3
.Owner
QQQQQ3
R0_^[]
_^[YY]
S	_^[]
TPUtilWindow
comctl32.dll
InitCommonControlsEx
TColor
EInvalidGraphic
EInvalidGraphicOperation
TFontPitch
	fpDefault
fpVariable
fpFixed
Graphics
	TFontName
TFontCharset
TFontStyle
fsBold
fsItalic
fsUnderline
fsStrikeOut
Graphics
TFontStyles
	TPenStyle
psSolid
psDash
psDot	psDashDot
psDashDotDot
psClear
psInsideFrame
Graphics
TPenMode
pmBlack
pmWhite
pmCopy	pmNotCopy
pmMergePenNot
pmMaskPenNot
pmMergeNotPen
pmMaskNotPen
pmMerge
pmNotMerge
pmMask	pmNotMask
pmNotXor
Graphics
TBrushStyle
bsSolid
bsClear
bsHorizontal
bsVertical
bsFDiagonal
bsBDiagonal
bsCross
bsDiagCross
Graphics
TGraphicsObject
TGraphicsObject
Graphics
IChangeNotifier
Graphics
TFontT
Graphics
Charset
ColorT
Height
PitchT
Graphics
StyleT
TBrush
TBrush
Graphics
TCanvas
TCanvas
Graphics
BrushT
CopyMode
TProgressStage
psStarting	psRunning
psEnding
Graphics
TProgressEvent
Sender
TObject
TProgressStage
PercentDone
	RedrawNow
Boolean
String
TGraphic
TGraphic
Graphics
TPicture
TPictureD
Graphics
TSharedImage
TMetafileImage
	TMetafile
	TMetafile
Graphics
TBitmapImage
TBitmapl
TBitmap
Graphics
TIconImage
TIcon4
Graphics
TResourceManager
_^[YY]
clBlack
clMaroon
clGreen
clOlive
clNavy
clPurple
clTeal
clGray
clSilver
clLime
clYellow
clBlue
clFuchsia
clAqua
clWhite
clMoneyGreen
clSkyBlue
clCream
clMedGray
clActiveBorder
clActiveCaption
clAppWorkSpace
clBackground
clBtnFace
clBtnHighlight
clBtnShadow
clBtnText
clCaptionText
clDefault
clGradientActiveCaption
clGradientInactiveCaption
clGrayText
clHighlight
clHighlightText
clHotLight
clInactiveBorder
clInactiveCaption
clInactiveCaptionText
clInfoBk
clInfoText
clMenu
clMenuBar
clMenuHighlight
clMenuText
clNone
clScrollBar
cl3DDkShadow
cl3DLight
clWindow
clWindowFrame
clWindowText
ANSI_CHARSET
DEFAULT_CHARSET
SYMBOL_CHARSET
MAC_CHARSET
SHIFTJIS_CHARSET
HANGEUL_CHARSET
JOHAB_CHARSET
GB2312_CHARSET
CHINESEBIG5_CHARSET
GREEK_CHARSET
TURKISH_CHARSET
HEBREW_CHARSET
ARABIC_CHARSET
BALTIC_CHARSET
RUSSIAN_CHARSET
THAI_CHARSET
EASTEUROPE_CHARSET
OEM_CHARSET
Default
E$PVSj
_^[YY]
C ;C$s
TFileFormat
TFileFormatsList
QQQQSV
TClipboardFormats
_^[YY]
_^[YY]
S`_^[Y]
kD$TdP
kD$PdP
D$LPkD$XdPV
D$HPkD$TdPV
|$( EMFt
TBitmapCanvas
TBitmapCanvasl
Graphics
_^[YY]
s(;~ t8
C(_^[Y]
TPatternManagerSV
_^[YY]
TObjectList
TOrderedList
TStack
GetMonitorInfoA
GetSystemMetrics
MonitorFromRect
MonitorFromWindow
MonitorFromPoint
GetMonitorInfo
DISPLAY
GetMonitorInfoA
DISPLAY
GetMonitorInfoW
DISPLAY
EnumDisplayMonitors
USER32.DLL
IHelpSelector
:	HelpIntfs
IHelpSystem
:	HelpIntfs
ICustomHelpViewer
:	HelpIntfs	
IExtendedHelpViewer
:	HelpIntfs
ISpecialWinHelpViewer,
:	HelpIntfs
IHelpManager
:	HelpIntfs
EHelpSystemException
THelpViewerNode
THelpManager
SVh<.C
comctl32.dll
InitializeFlatSB
UninitializeFlatSB
FlatSB_GetScrollProp
FlatSB_SetScrollProp
FlatSB_EnableScrollBar
FlatSB_ShowScrollBar
FlatSB_GetScrollRange
FlatSB_GetScrollInfo
FlatSB_GetScrollPos
FlatSB_SetScrollPos
FlatSB_SetScrollInfo
FlatSB_SetScrollRange
TSynchroObject
TCriticalSection
uxtheme.dll
OpenThemeData
CloseThemeData
DrawThemeBackground
DrawThemeText
GetThemeBackgroundContentRect
GetThemePartSize
GetThemeTextExtent
GetThemeTextMetrics
GetThemeBackgroundRegion
HitTestThemeBackground
DrawThemeEdge
DrawThemeIcon
IsThemePartDefined
IsThemeBackgroundPartiallyTransparent
GetThemeColor
GetThemeMetric
GetThemeString
GetThemeBool
GetThemeInt
GetThemeEnumValue
GetThemePosition
GetThemeFont
GetThemeRect
GetThemeMargins
GetThemeIntList
GetThemePropertyOrigin
SetWindowTheme
GetThemeFilename
GetThemeSysColor
GetThemeSysColorBrush
GetThemeSysBool
GetThemeSysSize
GetThemeSysFont
GetThemeSysString
GetThemeSysInt
IsThemeActive
IsAppThemed
GetWindowTheme
EnableThemeDialogTexture
IsThemeDialogTextureEnabled
GetThemeAppProperties
SetThemeAppProperties
GetCurrentThemeName
GetThemeDocumentationProperty
DrawThemeParentBackground
EnableTheming
TImage
TImage
ExtCtrls
Anchors
AutoSize
Center
Constraints
DragCursor<sD
DragKind
DragMode
Enabled
IncrementalDisplay
ParentShowHint
Picture
	PopupMenu
Proportional
ShowHint
Stretch
Transparent
Visible4
OnClickl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDragDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnProgress
OnStartDock
OnStartDrag
TTimer
TTimertAC
ExtCtrls
Enabled
Interval4
OnTimerU
TClipboard
TClipboard
Clipbrd
s'h@TC
Delphi Picture
Delphi Component
MAPI32.DLL
TTabChangingEvent
Sender
TObject
AllowChange
Boolean
TTabPosition
tpBottom
tpLeft
tpRight
ComCtrls
	TTabStyle
tsTabs	tsButtons
tsFlatButtons
ComCtrls4YC
TDrawTabEvent
Control
TCustomTabControl
TabIndex
Integer
Active
Boolean
TTabGetImageEvent
Sender
TObject
TabIndex
Integer
ImageIndex
Integer
TCustomTabControl
TCustomTabControlHZC
ComCtrls
	TTabSheet
	TTabSheet
ComCtrls 
BorderWidth
Caption
DragMode
Enabled
Height
Highlighted,
ImageIndexT
ConstraintsT
	PageIndex
ParentFont
ParentShowHint
	PopupMenu
ShowHint
TabVisibleT
VisibleT
Widthl|D
OnContextPopup0wD
OnDragDrop
OnDragOver
	OnEndDrag4
OnEnter4
OnExit4
OnHideDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp4
OnResize4
OnShow
OnStartDrag
TPageControl
TPageControl
ComCtrls3
ActivePage
Anchors
BiDiMode
Constraints
DockSite
DragCursor<sD
DragKind
DragMode
Enabled
HotTrack
Images
	MultiLine
	OwnerDraw
ParentBiDiMode
ParentFont
ParentShowHint
	PopupMenu
RaggedRight
ScrollOpposite
ShowHint
Style<
	TabHeightT
TabIndexpsD
TabOrder
TabPosition
TabStop<
TabWidth
Visible4
OnChange\XC
OnChangingl|D
OnContextPopup4xD
OnDockDrop
OnDockOver0wD
OnDragDrop
OnDragOver0YC
	OnDrawTab
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit
OnGetImageIndex
OnGetSiteInfoDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp4
OnResize
OnStartDock
OnStartDrag,yD
OnUnDock
TProgressBarOrientation
pbHorizontal
pbVertical
ComCtrls
TProgressBar
TProgressBar
ComCtrls!
AnchorsX
BorderWidth
DragCursor<sD
DragKind
DragMode
Enabled
ConstraintsT
MaxtjC
Orientation
ParentShowHint
	PopupMenuT
Position
SmoothT
ShowHintpsD
TabOrder
TabStop
Visiblel|D
OnContextPopup0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDrag4
OnEnter4
OnExitDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag
TConversion
TConversionFormat
comctl32.dll
TTabStrings
TTabStrings4rC
ComCtrls
SysTabControl32
_^[YY]
YZ]_^[
$Z]_^[
Sp]_^[
_^[YY]
msctls_progress32
TThemeServices
Theme manager 
 2001, 2002 Mike Lischke
 !"#$%
TCustomGroupBox
TCustomGroupBox
StdCtrls
	TGroupBox
	TGroupBox
StdCtrls*
Anchors
BiDiMode
Caption
Constraints
DockSite
DragCursor<sD
DragKind
DragMode
Enabled
ParentBackground
ParentBiDiMode
ParentColor
ParentCtl3D
ParentFont
ParentShowHint
	PopupMenu
ShowHintpsD
TabOrder
TabStop
Visible4
OnClickl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop4xD
OnDockDrop
OnDockOver
OnDragOver
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit
OnGetSiteInfoDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag,yD
OnUnDock
TTextLayout
tlCenter
tlBottom
StdCtrls
TCustomLabel
TCustomLabel
StdCtrls
TLabel
TLabelD
StdCtrls'
Alignx
	Alignment
Anchors
AutoSize
BiDiMode
Caption
Constraints
DragCursor<sD
DragKind
DragMode
Enabled`
FocusControl
ParentBiDiMode
ParentColor
ParentFont
ParentShowHint
	PopupMenu
ShowAccelChar
ShowHint
Transparentt
Layout
Visible
WordWrap4
OnClickl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDragDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp4
OnMouseEnter4
OnMouseLeave
OnStartDock
OnStartDrag
TEditCharCase
ecNormal
ecUpperCase
ecLowerCase
StdCtrls
TCustomEdit
TCustomEdit$
StdCtrls
TabStop
StdCtrls6
Anchors
AutoSelect
AutoSize
BevelEdgest
BevelInner
	BevelKindt
BevelOuter
BiDiMode0
BorderStyle
CharCase
Constraints
DragCursor<sD
DragKind
DragMode
Enabled
HideSelection
ImeModeH
ImeNameT
	MaxLength
OEMConvert
ParentBiDiMode
ParentColor
ParentCtl3D
ParentFont
ParentShowHint(
PasswordChar
	PopupMenu
ReadOnly
ShowHintpsD
TabOrder
TabStop
Visible4
OnChange4
OnClickl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag
TScrollStyle
ssNone
ssHorizontal
ssVertical
ssBoth
StdCtrls
TDrawItemEvent
Control
TWinControl
Integer
TOwnerDrawState
TMeasureItemEvent
Control
TWinControl
Integer
Height
Integer
TCustomComboBoxStrings
TCustomComboBoxStrings
StdCtrls
TCustomCombo
TCustomCombo
StdCtrls
TComboBoxStyle
csDropDown
csSimple
csDropDownList
csOwnerDrawFixed
csOwnerDrawVariable
StdCtrls
TCustomComboBox
TCustomComboBoxd
StdCtrls
	TComboBox
	TComboBoxL
StdCtrls:
AutoComplete
AutoDropDown
AutoCloseUp
BevelEdgest
BevelInner
	BevelKindt
BevelOuter
Anchors
BiDiMode
CharCase
Constraints
DragCursor<sD
DragKind
DragModeT
DropDownCount
Enabled
ImeModeH
ImeNameT
ItemHeightT
	ItemIndexT
	MaxLength
ParentBiDiMode
ParentColor
ParentCtl3D
ParentFont
ParentShowHint
	PopupMenu
ShowHint
SortedpsD
TabOrder
TabStop
Visible4
OnChange4
OnClick4
	OnCloseUpl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop
OnDragOver
OnDrawItem4
OnDropDown
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpL
OnMeasureItem4
OnSelect
OnStartDock
OnStartDrag
TButtonActionLink
TButtonControl
TButtonControl
StdCtrls
TButton
TButtonX
StdCtrls&
Action
Anchors
BiDiMode
Cancel
Caption
Constraints
Default
DragCursor<sD
DragKind
DragMode
Enabled
ModalResult
ParentBiDiMode
ParentFont
ParentShowHint
	PopupMenu
ShowHintpsD
TabOrder
TabStop
Visible
WordWrap4
OnClickl|D
OnContextPopup0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag(
TRadioButton
TRadioButton(
StdCtrls*
Action
	Alignment
Anchors
BiDiMode
Caption
Checked
Constraints
DragCursor<sD
DragKind
DragMode
Enabled
ParentBiDiMode
ParentColor
ParentCtl3D
ParentFont
ParentShowHint
	PopupMenu
ShowHintpsD
TabOrder
TabStop
Visible
WordWrap4
OnClickl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag
TListBoxStyle
lbStandard
lbOwnerDrawFixed
lbOwnerDrawVariable	lbVirtual
lbVirtualOwnerDraw
StdCtrls
TLBGetDataEvent
Control
TWinControl
Integer
String
TLBGetDataObjectEvent
Control
TWinControl
Integer	
DataObject
TObject
TLBFindDataEvent
Control
TWinControl
FindString
String
IntegerT
TCustomListBox
TCustomListBox
StdCtrls
TabStop
TListBox
TListBox$
StdCtrls=
AutoComplete
Anchors
BevelEdgest
BevelInner
	BevelKindt
BevelOuter
BiDiMode0
BorderStyle
ColorT
Columns
Constraints
DragCursor<sD
DragKind
DragMode
Enabled
ExtendedSelect
ImeModeH
ImeName
IntegralHeightT
ItemHeight
MultiSelect
ParentBiDiMode
ParentColor
ParentCtl3D
ParentFont
ParentShowHint
	PopupMenuT
ScrollWidth
ShowHint
SortedpsD
TabOrder
TabStopT
TabWidth
Visible4
OnClickl|D
OnContextPopup
OnData\
OnDataFind
OnDataObject4
OnDblClick0wD
OnDragDrop
OnDragOver
OnDrawItem
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpL
OnMeasureItemDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag
TStaticBorderStyle
sbsNone	sbsSingle	sbsSunken
StdCtrls
TCustomStaticText
TCustomStaticText
StdCtrls
TStaticText
TStaticText
StdCtrls*
Alignx
	Alignment
Anchors
AutoSize
BevelEdgest
BevelInner
	BevelKindt
BevelOuter
BiDiMode
BorderStyle
Caption
Constraints
DragCursor<sD
DragKind
DragMode
Enabled`
FocusControl
ParentBiDiMode
ParentColor
ParentFont
ParentShowHint
	PopupMenu
ShowAccelChar
ShowHintpsD
TabOrder
TabStop
Transparent
Visible4
OnClickl|D
OnContextPopup4
OnDblClick0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDragDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag
TComboBoxStrings
TComboBoxStringsL
StdCtrls
TListBoxStrings
TListBoxStringsX
StdCtrls
GH+D$	
_^[YY]
COMBOBOX
QQQQQQQSVW
BUTTON
_^[YY]
BUTTON
_^[YY]
_^[YY]
_^[YY]
_^[YY]
_^[YY]
QQQQQQSVW
!G$_^[
LISTBOX
YZ]_^[
STATIC
THintAction
THintActionH^D
StdActns
TWinHelpViewer
_^[YY]
_^[YY]
IE(AL("%s",4),"AL(\"%0:s\",3)","JK(\"%1:s\",\"%0:s\")")
JumpID("","%s")
_^[YY]
MS_WINHELP
#32770
TModalResult
TCursor
TAlign
alNone
alBottom
alLeft
alRight
alClient
alCustom
Controls
TDragObject
TDragObject`mD
Controls
TBaseDragControlObject
TBaseDragControlObject
Controls
TDragControlObject
TDragControlObjectEx
TDragDockObject4pD
TDragDockObject
Controls
TDragDockObjectEx
TControlCanvas
TControlCanvasDqD
Controls
TControlActionLink
TMouseButton
mbLeft
mbRight
mbMiddle
Controls
	TDragMode
dmManual
dmAutomatic
Controls
TDragState
dsDragEnter
dsDragLeave
dsDragMove
Controls
	TDragKind
dkDrag
dkDock
Controls
	TTabOrder
TCaption
TAnchorKind
akLeft
akRight
akBottom
Controls
TAnchors
TConstraintSize
TSizeConstraints
TSizeConstraints`tD
Controls
	MaxHeight
MaxWidth
	MinHeight
MinWidth
TMouseEvent
Sender
TObject
Button
TMouseButton
TShiftState
Integer
Integer
TMouseMoveEvent
Sender
TObject
TShiftState
Integer
Integer
	TKeyEvent
Sender
TObject
TShiftState
TKeyPressEvent
Sender
TObject
TDragOverEvent
Sender
TObject
Source
TObject
Integer
Integer
TDragState
Accept
Boolean
TDragDropEvent
Sender
TObject
Source
TObject
Integer
Integer
TStartDragEvent
Sender
TObject	
DragObject
TDragObject
TEndDragEvent
Sender
TObject
Target
TObject
Integer
Integer
TDockDropEvent
Sender
TObject
Source
TDragDockObject
Integer
Integer
TDockOverEvent
Sender
TObject
Source
TDragDockObject
Integer
Integer
TDragState
Accept
Boolean
TUnDockEvent
Sender
TObject
Client
TControl
	NewTarget
TWinControl
Boolean
TStartDockEvent
Sender
TObject	
DragObject
TDragDockObject
TGetSiteInfoEvent
Sender
TObject
DockClient
TControl
InfluenceRect
MousePos
TPoint
CanDock
Boolean
TCanResizeEvent
Sender
TObject
NewWidth
Integer
	NewHeight
Integer
Resize
Boolean
TConstrainedResizeEvent
Sender
TObject
MinWidth
Integer
	MinHeight
Integer
MaxWidth
Integer
	MaxHeight
Integer
TMouseWheelEvent
Sender
TObject
TShiftState
WheelDelta
Integer
MousePos
TPoint
Handled
Boolean
TMouseWheelUpDownEvent
Sender
TObject
TShiftState
MousePos
TPoint
Handled
Boolean
TContextPopupEvent
Sender
TObject
MousePos
TPoint
Handled
Boolean
TControl
TControl
Controls	
WidthT
Height
Cursor
HelpType
HelpKeyword
HelpContext$
TWinControlActionLink
TImeMode
	imDisable
imClose
imOpen
imDontCare
imSAlpha
imAlpha
imHira
imSKata
imKata	imChinese
imSHanguel	imHanguel
Controls
TImeName
TBorderWidth
	TBevelCut
bvNone	bvLowered
bvRaised
bvSpace
Controls
TBevelEdge
beLeft
beRight
beBottom
Controls
TBevelEdges
TBevelKind
bkNone
bkTile
bkSoft
bkFlat
Controls
TBevelWidth
IDockManager
Controls
TWinControl
TWinControl
Controls
TGraphicControl
TGraphicControl
Controls
TCustomControl
TCustomControl
Controls
THintWindow
THintWindowP
Controls
TDragImageList
TDragImageList
Controls
TImageList
TImageList
Controls
BlendColor
BkColorT
AllocBy
DrawingStyleT
Height
	ImageType
Masked4
OnChange
ShareImagesT
	TDockZone
	TDockTree
TMouse
TCustomListControl
TCustomListControl
Controls
TCustomMultiSelectListControl
TCustomMultiSelectListControl\
Controls
crDefault
crArrow
crCross
crIBeam
crSizeNESW
crSizeNS
crSizeNWSE
crSizeWE
crUpArrow
crHourGlass
crDrag
crNoDrop
crHSplit
crVSplit
crMultiDrag
crSQLWait
crAppStart
crHelp
crHandPoint
crSizeAll
crSize
	TSiteList
_^[YY]
S$_^[]
YZ]_^[
t%Jt?Jt[
%s (%s)
YZ]_^[
u$;~|u
tr;s@u
;CLtX3
_^[YY]
;s0t=;
IsControl
_^[YY]
_^[YY]
+WH+W@
:GauOFKu
DesignSize
_^[YY]
,;=<{L
_^[YY]
_^[YY]
YZ]_^[
YZ]_^[
YZ]_^[
YZ]_^[
S8_^[]
t9;wlt4
^dVh4hE
^dVh4hE
t$;C8u
QQQQSVW
t#;^dt
BP_^[]
USER32
WINNLSEnableIME
imm32.dll
ImmGetContext
ImmReleaseContext
ImmGetConversionStatus
ImmSetConversionStatus
ImmSetOpenStatus
ImmSetCompositionWindow
ImmSetCompositionFontA
ImmGetCompositionStringA
ImmIsIME
ImmNotifyIME
Delphi%.8X
ControlOfs%.8X%.8X
USER32
AnimateWindow
TContainedAction
TContainedAction
ActnList
Category
TCustomActionList
TCustomActionList 
ActnList
TShortCutList
TShortCutList
ActnList
TCustomAction
TCustomAction
ActnList
TActionLinkSV
u*;~8u
R0Z_^[
;Blu	3
$:Cjt_
R0Z_^[
R0]_^[
$;Ctt?
R0Z_^[
R0Z_^[
R0Z_^[
R0Z_^[
R0]_^[
$Z]_^[
TChangeLink
TDrawingStyle
dsFocus
dsSelected
dsNormal
dsTransparent
ImgList
TImageType
itImage
itMask
ImgList0
TImageIndex
TCustomImageList
TCustomImageList
ImgList
S0_^[]
R ;C0|
R,;C4}!
S`]_^[
Bitmap
comctl32.dll
comctl32.dll
ImageList_WriteEx
EMenuError
TMenuBreak
mbNone
mbBreak
mbBarBreak
TMenuChangeEvent
Sender
TObject
Source	TMenuItem
Rebuild
Boolean
TMenuDrawItemEvent
Sender
TObject
ACanvas
TCanvas
Selected
Boolean
TAdvancedMenuDrawItemEvent
Sender
TObject
ACanvas
TCanvas
TOwnerDrawState
TMenuMeasureItemEvent
Sender
TObject
ACanvas
TCanvas
Integer
Height
Integer
TMenuItemAutoFlag
maAutomatic
maManual
maParent
MenusH
TMenuAutoFlag
TMenuActionLink
	TMenuItem,
	TMenuItem
Action
	AutoCheck
AutoHotkeys
AutoLineReductionh
Bitmap
Caption
Checked
SubMenuImages
Default
Enabledl
GroupIndex
HelpContext
ImageIndex
	RadioItem
ShortCut
Visible4
OnClick
OnDrawItem
OnAdvancedDrawItem
OnMeasureItem
TMenu 
	TMainMenu
	TMainMenu
AutoHotkeysD
AutoLineReduction
	AutoMerge
BiDiMode
Images
	OwnerDraw
ParentBiDiModeP
OnChange
TPopupAlignment
paLeft
paRight
paCenter
TTrackButton
tbRightButton
tbLeftButton
TMenuAnimations
maLeftToRight
maRightToLeft
maTopToBottom
maBottomToTop
maNone
TMenuAnimation
TPopupMenu
TPopupMenu
	AlignmentD
AutoHotkeysD
AutoLineReduction
	AutoPopup
BiDiMode
HelpContext
Images$
MenuAnimation
	OwnerDraw
ParentBiDiMode|
TrackButtonP
OnChange4
OnPopup
TPopupList
TMenuItemStack
1234567890ABCDEFGHIJKLMNOPQRSTUVWXYZ
_^[YY]
Q<]_^[
ShortCutText
P?:S?u
Q<]_^[
@?:F?v
Q<]_^[
;~hu	3
$YZ]_^[
_^[YY]
Ih;J4u
YZ]_^[
TScrollBarInc
TScrollBarStyle
	ssRegular
ssFlat
ssHotTrack
TControlScrollBar
TControlScrollBar
ButtonSize
	Increment
Margin
ParentColorT
PositionT
SmoothT
StyleT
	ThumbSize
Tracking
Visible
TWindowState
wsNormal
wsMinimized
wsMaximized
TScrollingWinControl
TScrollingWinControl<
HorzScrollBar
VertScrollBar
TFormBorderStyle
bsNone
bsSingle
bsSizeable
bsDialog
bsToolWindow
bsSizeToolWin
Forms4
TBorderStyle
IDesignerHook
Forms	
IOleForm
TFormStyle
fsNormal
fsMDIChild	fsMDIForm
fsStayOnTop
TBorderIcon
biSystemMenu
biMinimize
biMaximize
biHelp
TBorderIcons
	TPosition
poDesigned	poDefault
poDefaultPosOnly
poDefaultSizeOnly
poScreenCenter
poDesktopCenter
poMainFormCenter
poOwnerFormCenter
TDefaultMonitor
	dmDesktop	dmPrimary
dmMainForm
dmActiveForm
Formsh
TPrintScale
poNone
poProportional
poPrintToFit
TCloseAction
caNone
caHide
caFree
caMinimize
TCloseEvent
Sender
TObject
Action
TCloseAction
TCloseQueryEvent
Sender
TObject
CanClose
Boolean
TShortCutEvent
TWMKey
Handled
Boolean
THelpEvent
Command
Integer
CallHelp
Boolean
Boolean
TCustomForm
TCustomForm`
TFormd
FormsU
Action`
ActiveControl
AlphaBlendl
AlphaBlendValue
Anchors
AutoScroll
AutoSize
BiDiMode\
BorderIcons
BorderStyleX
BorderWidth
CaptionT
ClientHeightT
ClientWidth
TransparentColor
TransparentColorValue
Constraints
UseDockManager
DefaultMonitor
DockSite<sD
DragKind
DragMode
Enabled
ParentFont
	FormStyleT
Height
HelpFile
HorzScrollBar
KeyPreview
OldCreateOrder(
ObjectMenuItem
ParentBiDiModeT
PixelsPerInch
	PopupMenut
Positiond
PrintScale
Scaled
ScreenSnap
ShowHintT
SnapBuffer
VertScrollBar
VisibleT
WindowState(
WindowMenu4
OnActivatepzD
OnCanResize4
OnClick
OnClose8
OnCloseQuery
OnConstrainedResizel|D
OnContextPopup4
OnCreate4
OnDblClick4
	OnDestroy4
OnDeactivate4xD
OnDockDrop
OnDockOver0wD
OnDragDrop
OnDragOver
	OnEndDock
OnGetSiteInfo4
OnHide
OnHelp vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUpp{D
OnMouseWheel
OnMouseWheelDown
OnMouseWheelUp4
OnPaint4
OnResize|
OnShortCut4
OnShow
OnStartDock,yD
OnUnDock
TCustomDockFormD,F
TCustomDockForm
PixelsPerInch
TMonitor
TScreen
TScreen4-F
	THintInfo@
TApplication
TApplication
;X0t@S
+WH+W@
PixelsPerInch
TextHeight
IgnoreFontProperty
_^[YY]
S,_^[]
$Z]_^[
F(Z_^[
MDICLIENT
_^[YY]
_^[YY]
_^[YY]
Ch;Ctt
Cd;Cpt
System\CurrentControlSet\Control\Keyboard Layouts\%.8x
layout text
f;sDtsf
CHYZ]_^[
_^[YY]
TApplication
MAINICON
XD;PHu
sx;P`u
;B0uGj
_^[YY]
vcltest3.dll
RegisterAutomation
$Z]_^[
Y_^[Y]
YZ]_^[
User32.dll
SetLayeredWindowAttributes
TaskbarCreated
TCommonDialog
TCommonDialog(
Dialogs
HelpContext4
OnClose4
OnShowSV
TMessageForm
TMessageFormX
Dialogs
_^[YY]
%s%s%s%s%s%s%s%s%s%s
Cancel
Ignore
NoToAll
YesToAll
Message
commdlg_help
commdlg_FindReplace
WndProcPtr%.8X%.8X
TMaskedText
	TEditMask
$Z]_^[
_^[YY]
TSQLTimeStampVariantType
TSQLTimeStampData
TSQLTimeStampData4
SqlTimSt	
AsDateTime
AsString
	Fractions
Minute
Second<
EBcdException
EBcdOverflowException
TFMTBcdVariantType
TFMTBcdData|
TFMTBcdData`
FMTBcd
AsCurrency
AsDoubleT
	AsInteger<
AsSmallInt
AsStringU
QQQQSVW
ZY[_^]
QVWSQRf
ZY[_^Y]
QVWSQRf
ZY[_^Y]
QVWSRf
\$&US3
_^[YY]
_^[YY]
(%s%s)
-%s %s
%s %s-
%s -%s
(%s- %s)
(%s %s)
_^[YY]
TLiteralInfo
V,#tR,	tN,
EDatabaseError
EDatabaseError
EUpdateError
TFieldType
	ftUnknown
ftString
ftSmallint	ftInteger
ftWord	ftBoolean
ftFloat
ftCurrency
ftDate
ftTime
ftDateTime
ftBytes
ftVarBytes	ftAutoInc
ftBlob
ftMemo	ftGraphic	ftFmtMemo
ftParadoxOle
ftDBaseOle
ftTypedBinary
ftCursor
ftFixedChar
ftWideString
ftLargeint
ftArray
ftReference	ftDataSet	ftOraBlob	ftOraClob	ftVariant
ftInterface
ftIDispatch
ftGuid
ftTimeStamp
ftFMTBcd
TUpdateAction
uaFail
uaAbort
uaSkip
uaRetry	uaApplied
TUpdateMode
upWhereAll
upWhereChanged
upWhereKeyOnly
TUpdateKind
ukModify
ukInsert
ukDelete
TUpdateErrorEvent
DataSet
TDataSet
EDatabaseError
UpdateKind
TUpdateKind
UpdateAction
TUpdateAction
TUpdateRecordEvent
DataSet
TDataSet
UpdateKind
TUpdateKind
UpdateAction
TUpdateAction
TCustomConnection
TCustomConnection0SG
TNamedItem
TNamedItem
TDefCollection
TDefCollection
TFieldAttribute
faHiddenCol
faReadonly
faRequired
faLink	faUnNamed
faFixed
TFieldAttributes
	TFieldDef
	TFieldDef
AttributestWG
	ChildDefs
DataTypeT
	PrecisionT
TFieldDefs
TFieldDefs@WG
TIndexOption
	ixPrimary
ixUnique
ixDescending
ixCaseInsensitive
ixExpression
ixNonMaintained
TIndexOptions
	TIndexDef
	TIndexDeflXG
CaseInsFields
DescFields
Expression
Fields
Options
SourceT
GroupingLevel(ZG
	TFlatList
	TFlatList(ZG
TFieldDefList
TFieldDefList@[G
TFieldList
TFieldList`\G
TFieldKind
fkData
fkCalculated
fkLookup
fkInternalCalc
fkAggregate
TFields
TProviderFlag
pfInUpdate	pfInWhere
pfInKey
pfHidden
TProviderFlags
TFieldNotifyEvent
Sender
TField
TFieldGetTextEvent
Sender
TField
String
DisplayText
Boolean
TFieldSetTextEvent
Sender
TField
String
TAutoRefreshFlag
arNone	arAutoInc	arDefault
TLookupListEntry 
TLookupList `G
TField
TField `G
	Alignment
AutoGenerateValue
CustomConstraint
ConstraintErrorMessage
DefaultExpression
DisplayLabelT
DisplayWidth,]G
	FieldKind
	FieldName
HasConstraintsT
ImportedConstraint
LookupDataSet
LookupKeyFields
LookupResultField
	KeyFields
LookupCache
Origin$^G
ProviderFlags
ReadOnly
Required
Visible@^G
OnChangep^G
	OnGetText
	OnSetText@^G
OnValidate
TStringField
TStringField
EditMask
	FixedCharT
Transliterate
TWideStringField
TWideStringField
TNumericField@jG
TNumericField4iG
	Alignment
DisplayFormat
EditFormat
TIntegerField
TIntegerField
MaxValueT
MinValue
TSmallintField
TSmallintField
TLargeintField
TLargeintField nG
MaxValue
MinValue
TWordField
TWordField
TAutoIncField
TAutoIncField qG
TFloatFieldpsG
TFloatField
currency
MaxValue
MinValueT
	Precision
TCurrencyField
TCurrencyFieldhtG
currency
TBooleanField
TBooleanField
DisplayValues
TDateTimeField
TDateTimeField
DisplayFormat 
EditMask
TSQLTimeStampField
TSQLTimeStampFielddyG
DisplayFormat 
EditMask
TDateField
TDateField,{G
TTimeField
TTimeField
TBinaryField
TBinaryField
TBytesFieldH
TBytesFieldX
TVarBytesField
TVarBytesField
	TBCDField
	TBCDField
currency
MaxValue
MinValueT
	PrecisionT
TFMTBCDField
TFMTBCDField
currency
MaxValue
MinValueT
	PrecisionT
	TBlobType
TBlobField
TBlobFieldX
BlobType
GraphicHeaderT
TMemoField
TMemoField 
Transliterate
TGraphicField
TGraphicField
TObjectField
TObjectField
ObjectType
	TADTField
	TADTField
TArrayField
TArrayField
TDataSetField
TDataSetField
IncludeObjectField
TReferenceField
TReferenceField
ReferenceTableNameT
TVariantField
TVariantField
TInterfaceField8
TInterfaceFieldD
TIDispatchField
TIDispatchField
TGuidField
TGuidField
	TDataLink
	TDataLink\
TDetailDataLink
TDetailDataLink4
TDataChangeEvent
Sender
TObject
TField
TDataSource
TDataSourceL
AutoEdit
DataSet
Enabled4
OnStateChange
OnDataChange4
OnUpdateData
TCheckConstraint
TCheckConstraint
CustomConstraint
ErrorMessage
FromDictionary
ImportedConstraint
TCheckConstraints
TCheckConstraintsD
TParamType
	ptUnknown
ptInput
ptOutput
ptInputOutput
ptResult
TParam
TParamP
DataTypeT
	PrecisionT
NumericScale
	ParamTypeT
TParams0
TParams
TBufferList
TDataAction
daFail
daAbort
daRetry
TDataSetNotifyEvent
DataSet
TDataSet
TDataSetErrorEvent
DataSet
TDataSet
EDatabaseError
Action
TDataAction
TFilterOption
foCaseInsensitive
foNoPartialCompare
TFilterOptions
TFilterRecordEvent
DataSet
TDataSet
Accept
Boolean
TPacketAttribute 
TBlobByteData
TDataSet
TDataSetL
Unknown
String
SmallInt
Integer
Boolean
Currency
DateTime
VarBytes
AutoInc
Graphic
FmtMemo
ParadoxOle
dBaseOle
TypedBinary
Cursor
FixedChar
WideString
LargeInt
Reference
DataSet
HugeBlob
HugeClob
Variant
Interface
Dispatch
SQLTimeStamp
FMTBcdField
%s: %s
_^[YY]
Required
_^[YY]
%s[%d]
%s[%d]
QQQQSV
AttributeSet
Calculated
Lookup
Boolean
DateTime
Integer
SQLTimeStamp
Variant
Boolean
DateTime
Integer
SQLTimeStamp
String
^B^[Y]
Variant
Variant
QQQQSVW
UnNamed
_^[YY]
QQQQQSVW
QQQQQQSVW
QQQQSV
QQQQQQS
QQQQSV
QQQQQQS
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
<Primary>
C9:F9u
QQQQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
QQQQSV
t;;^4t
_^[YY]
Y_^[YY]
FX;FTu;
FP;FL}
CP;CL}
CP;CL}
QQQQQQSV
CP;CL}
_^[YY]
TDefaultDBScreenApplication
EDBEditError
TCustomMaskEdit0
TCustomMaskEdit
	TMaskEdit
	TMaskEdit
Anchors
AutoSelect
AutoSize
BevelEdgest
BevelInnert
BevelOuter
	BevelKind\
BevelWidth
BiDiMode0
BorderStyle
CharCase
Constraints
DragCursor<sD
DragKind
DragMode
Enabled 
EditMask
ImeModeH
ImeNameT
	MaxLength
ParentBiDiMode
ParentColor
ParentCtl3D
ParentFont
ParentShowHint(
PasswordChar
	PopupMenu
ReadOnly
ShowHintpsD
TabOrder
TabStop
Visible4
OnChange4
OnClick4
OnDblClick0wD
OnDragDrop
OnDragOver
	OnEndDock
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp
OnStartDock
OnStartDrag
QQQQSV
EInvalidGridOperation
TInplaceEdit
TInplaceEdit
gdSelected	gdFocused
gdFixed
Grids\
TGridDrawState
TCustomGrid
TCustomGrid
TabStop
_^[YY]
ColWidths
RowHeights
Y_^[Y]
G8;G<}@
C,_^[YY]
;p4}:U
Y^[YY]
;D$ ~	
_^[YY]
_^[YY]
6;D$$~0
	;D$T~
EArrayErrorT3I
EUnsupportedTypeError
ELowCapacityError
TStringItem
TBaseArray
TBaseArray<4I
Mxarrays
TSmallIntArray
TSmallIntArray
Mxarrays
	TIntArray
	TIntArray
Mxarrays
TSingleArray
TSingleArrayP6I
Mxarrays
TDoubleArray
TDoubleArray
Mxarrays
TCurrencyArray
TCurrencyArray
Mxarrays
TWordArray
TWordArrayp8I
Mxarrays
TStringArray
TStringArray 9I
Mxarrays
EDynArrayRangeError4:I
TTwoDimArray
TIndexArray
TCustomArray
TThreadCustomArray
_^[YY]
$YZ_^[
_^[YY]
_^[YY]
_^[YY]
_^[YY]
$YZ_^[
_^[YY]
_^[YY]
_^[YY]
_^[YY]
_^[YY]
_^[YY]
$YZ_^[
_^[YY]
_^[YY]
OleStr
Dispatch
Variant
TypeMask
Unknown
t)Nt>N
t-JtjJ
QQQQQSV
t1JtqJ
VSmallInt
t*It4ItXIt;
t:JtGJtuJtP
I H G F E D C B A @ ? > = < ; : 9 8 
9#8#7#6#5#4#3#1#/#.#-#+#
uJh$`L
_^[YY]
	TExprData
DBCommon
	TExprNode0
TFilterExpr
TExprParser
TFieldInfo
DISTINCT
ASCENDING
DESCENDING
SELECT
HAVING
UPDATE
_^[YY]
s<^[Y]
t}</uy
QQQQSV
QQQQSV
QQQQSV
QQQQQQQSVW
QQQQQQQSVW
COUNT(*)
COUNT(*)
GETDATE
MINUTE
SECOND
SUBSTRING
TRIMLEFT
TRIMRIGHT
MINUTE
SECOND
GETDATE
	ISMClient
SMINTF
EDBEngineError
ENoResultSet
TDBError
TBDECallback
TSessionList
TPasswordEvent
Sender
TObject
Continue
Boolean
TSession
TSession4
DBTables	
Active
AutoSessionName
KeepConnections
NetFileDir
PrivateDir
SessionName
SQLHourGlass 
OnPassword4
	OnStartup
TFieldDescList>
DBTables
TTransIsolation
tiDirtyRead
tiReadCommitted
tiRepeatableRead
DBTables
TDatabaseLoginEvent
Database	TDatabase
LoginParams
TStrings
	TDatabase
	TDatabase4
DBTables
	AliasName
	Connected
DatabaseName
DriverName
	Exclusive
HandleShared
KeepConnection
LoginPrompt
Params
ReadOnly
SessionName@
TransIsolation4
AfterConnect4
AfterDisconnect4
BeforeConnect4
BeforeDisconnect
OnLogin
TDataSetUpdateObject
TDataSetUpdateObject
DBTables
TBDEDataSet
TBDEDataSetx
DBTables
Active
AutoCalcFields
CachedUpdates
ObjectView
BeforeOpen
	AfterOpen
BeforeClose
AfterClose
BeforeInsert
AfterInsert
BeforeEdit
	AfterEdit
BeforePost
	AfterPost
BeforeCancel
AfterCancel
BeforeDelete
AfterDelete
BeforeScroll
AfterScroll
BeforeRefresh
AfterRefresh
OnCalcFields
OnDeleteError
OnEditError
OnNewRecord
OnPostError
OnUpdateErrortRG
OnUpdateRecord
TNestedTable
TNestedTable
DBTables
DataSetField
ObjectView
TDBDataSet
TDBDataSet
DBTables
AutoRefresh
DatabaseName
Filter
Filtered
FilterOptions
SessionName
OnFilterRecord
TQuery
TQuery
DBTables
Constrained
Constraints
DataSource
ParamCheck
RequestLive
Params
UniDirectionalhQG
UpdateMode
UpdateObject
TBlobStream
TQueryDataLink
TQueryDataLink
DBTables
QQQQQS
_^[YY]
_^[YY]
_^[YY]
%s%s:"%s";
RL;Pxu
USER NAME
YZ]_^[
STANDARD
\DATABASES\%s\DB INFO
\DATABASES\%s\DB OPEN
STANDARD
DEFAULT DRIVER
PARADOX
ENABLE BCD
\DRIVERS\%s\DB OPEN
DEFAULT DRIVER
STANDARD
PARADOX
\DATABASES\%s
u'h@;J
SMBuffer
CpPjPSh
PO[YY]
_^[YY]
	TStmtInfo
STANDARD
QQQQQSVW
USER NAME
PASSWORD
QQQQSVW3
PASSWORD
USER NAME
PASSWORD
MTS CONTEXT OBJECT
t	TQRV
$Z]_^[
_^[YY]
_^[YY]
QQQQQQQS
ParamData
_^[YY]
Default
EUserCanceled
ProgressBar
CancelButton
StatusText
CancelButtonClick
FormActivate
FormCreate
TProgressDialog
TProgressDialog
MXPBAR
IQStmt
MXQEDCOM4
EQParseException
recProjectorInfo
TXtabQuery
IDSQL32.DLL
CLSID\{FB99D700-18B9-11D0-A4CF-00A024C91936}\InProcServer32
SOFTWARE\BORLAND\DATABASE ENGINE
DLLPATH
TDecisionQuery
TDecisionQuery4
MXTABLES
EDimensionMapError
TBinType
binNone
binYear
binQuarter
binMonth
binSet	binCustom
MXCOMMON
TActiveFlags
diActive
diAsNeeded
diInactive
MXCOMMON
	TDimFlags
dimDimension
dimSum
dimCount
dimAverage
dimMin
dimMax
dimGenericAgg
dimUnknown
MXCOMMON
TDimensionItem
TDimensionItem
MXCOMMON
ActiveFlag
Format
	FieldType
	Fieldname
BaseName
DerivedFromH
DimensionType
TDimensionItemsD
TDimensionItems
MXCOMMON
TBinData
TBinData
MXCOMMON
_^[YY]
$Z]_^[
YZ]_^[
TErrorAction
eaFail
eaContinue
Mxstore
TCapacityErrorEvent
EAction
TErrorAction
TCubeNotifyEvent
DataCube
TCustomDataStore
TCubeRefreshEvent
DataCube
TCustomDataStore
DimMap	TCubeDims
TCubeDim
TCubeDimX
Mxstore
BinTypeT
ValueCount
	TCubeDims
	TCubeDims`
Mxstore
TCustomDataStore
TCustomDataStore
Mxstore
TMultiDimDataLink
TMultiDimDataLink
Mxstore
TFieldDefinition
TDimension
TIndexInfo
TAggDefinition
TSummary
ECacheErrorH
TDataCache
TBuilderDim
_^[YY]
_^[YY]
_^[YY]
R4_^[Y]
YZ]_^[
YZ]_^[
	TBinTable
	TBinTablet
Mxstore
TmpTab
PARADOX
LANGDRIVER
PARADOX
ASCIIDRV
F(^[Y]
STANDARD
_^[YY]
_^[YY]
@(;E(|1
@(;E(~
$Z]_^[
@(;E(|1
@(;E(~
$Z]_^[
$Z]_^[
$Z]_^[
QQQQSV
mmm, yyyy
"Q"m, yyyy
SingleValue
Active
DateBin
StartDate
StartValue
binNone
binYear
binQuarter
binMonth
binSet
binCustom
TQuickMenuItem
TQuickMenuItem
MXBUTTON
TQuickMenu
TQuickMenu
MXBUTTON
ECubeDesignError
	FieldList
RadioMetaData
RadioDimensionData
RadioAllData
RadioNoData
Panel1
CaptionEdit
CaptionLabel
ActiveLabel
BinLabel 
StartLabel$
	TypeLabel(
ActiveEdit,
BinEdit0
TypeEdit4
Pager8
DimensionInfo<
MemoryControl@
Label1D
Label2H
FormatEditL
	StartEditP
OKButtonT
CancelButtonX
HelpButton\
NActiveDims`
nDemandDimsd
Label4h
Label7l
Label9p
NActiveSumst
NDemandSumsx
Label6|
MaxDims
MaxSums
MaxCells
Label5
Label12
nDemandCells
GetCellCounts
CubeLimits
ValueCount
Label3
	nCurrDims
	nCurrSums
nCurrCells
BaseNameLabel
BaseNameEdit
RadioDimensionDataClick
RadioMetaDataClick
RadioAllDataClick
RadioNoDataClick
FieldListClick
OKButtonClick
HandleFieldEdit
HandleBeginEdit
ActiveEditChange
CancelButtonClick
PagerChange
GetCellCountsClick
FormKeyPress
HelpButtonClick
TDssCubeEditor
TDssCubeEditor
MXDCUBE
QQQQSVW
_^[YY]
QQQQQSVW
MemoryControl
EArrayError
TDecisionControlType
xtCheck
xtRadio	xtRadioEx
TIArray
TDimInfoArray
TPivotState
TDecisionDataLink
TDecisionDataLink
TDecisionSource
TDecisionSourceD
DecisionCube
ControlType
SparseRows
SparseCols4
OnStateChange4
OnNewDimensions4
OnLayoutChange4
OnSummaryChange4
OnBeforePivot4
OnAfterPivot
TDecisionCube
TDecisionCube
DataSet
DimensionMap
ShowProgressDialogT
MaxDimensionsT
MaxSummariesT
MaxCellsL
OnLowCapacity
BeforeOpen
	AfterOpen
BeforeClose
AfterClose
	OnRefreshSV
$YZ]_^[
$YZ]_^[
PPEFOu
DimensionCount
SummaryCount
CurrentSummary
SparseRows
SparseCols
DimensionInfo
Q<^[Y]
_^[YY]
_^[YY]
Q<]_^[
TValueArray
TValueArray
MXGRID
TDecisionGridOption
cgGridLines
cgOutliner
cgPivotable
MXGRIDt
TDecisionGridOptions
TDecisionDrawStates
dsGroupStart
dsRowCaption
dsColCaption
dsRowValue
dsColValue
dsData
dsOpenAfter
dsCloseAfter
dsCloseBefore
dsOpenBefore
dsRowIndicator
dsColIndicator	dsRowPlus	dsColPlus
dsNone
MXGRIDx
TDecisionDrawState
TDecisionDrawCellEvent
Sender
TObject
Integer
Integer
String	
aColor
TColor
AState
TGridDrawState
aDrawState
TDecisionDrawState
TDecisionExamineCellEvent
Sender
TObject
Integer
Integer
Integer
ValueArray
TValueArray
TDecisionGridDataLink
TDecisionGridDataLink4
MXGRID
TDisplayDim
TDisplayDim
MXGRID
DisplayName
	FieldName
Formatx
	Alignment
	Subtotals
TDisplayDims
TDisplayDimsl
MXGRID
TCustomDecisionGridL
TCustomDecisionGrid 
MXGRID
TDecisionGrid
TDecisionGrid
MXGRID7
OptionsT
DefaultColWidthT
DefaultRowHeight
CaptionColor
CaptionFont
	DataColor
DataSumColor
DataFont
	LabelFont
LabelColor
LabelSumColor
DecisionSource
Dimensions
Totals
ShowCubeEditor
Anchors0
BorderStyle
Constraints
DefaultDrawing
DragCursor
DragMode
EnabledT
GridLineWidth
GridLineColor
ParentColor
ParentCtl3D
ParentFont
ParentShowHint
	PopupMenu
ScrollBars
ShowHintpsD
TabOrder
TabStop
Visible4
OnClick4
OnDblClick0wD
OnDragDrop
OnDragOver
OnDecisionDrawCell`
OnDecisionExamineCell
	OnEndDrag4
OnEnter4
OnExit vD
	OnKeyDownlvD
OnKeyPress vD
OnKeyUpDuD
OnMouseDown
OnMouseMoveDuD
	OnMouseUp4
OnResize
OnStartDrag4
OnTopLeftChanged
LeftArrow
RightArrow
Caption
DClose
QQQQQQQSVW
YZ]_^[
WIGIYJEHQJKJKJGGPIGIYJEHQJKJKJGIBIUJHJLIUJJJKGPGWGPGS
EGWGUHK
XHKHNHYHNHLGQIDJLJJIVIRJE
responseBody
savetofile
HHMIDISIJIQIUIJIOIHGAGYIJIMIFHMJAITIUIFINHIICIKIFIDIU
IHNIJIGININGBGUIRIRINIKIEICIVIKIQIP
getFolder
NameSpace
getFile
CopyHere
_^[YY]
KGYGPHYHRIWIIIVIWHYHMIYIFIPIMIGHY
JHSHOIFIUILISIWGCHOIKIHIOIO
%COMPUTERNAME%
HexpandEnvironmentStrings
HHMIDISIJIQIUIJIOIHGAGYIJIMIFHMJAITIUIFINHIICIKIFIDIU
CreateTextFile
Hwrite
YJAJMJMJIHEGSGSIVJNJGJHJKJMIWJKIWIXJKJBIYIWJKISIUISJHJEJMIVISJQGTGVGRJBJGIXJHGSJFJHIVIXITGTGYGSISJAGYIS
XJDJGIRIUGPITGU
LGEJFINIU
SGLIPITIR
AHTIBGA
SJEJHJAIPIXIXGQGPGLIQJKIQFWFW
CFSHXHVINHVIE
Runtime error     at 00000000
0123456789ABCDEF
%.*d0v@
MS Sans Serif
idapi32.DLL
Software\Borland\Database Engine
DLLPATH
LIBLDRMUX
Not Enough Memory
DLLINITFUNCTION
IDAPI32.DLL
DLLEXITFUNCTION
DLLEXITFUNCTION2
IDAPI32.DLL
DbiInitFn
DbiExit
kernel32.dll
DeleteCriticalSection
LeaveCriticalSection
EnterCriticalSection
InitializeCriticalSection
VirtualFree
VirtualAlloc
LocalFree
LocalAlloc
GetTickCount
QueryPerformanceCounter
GetVersion
GetCurrentThreadId
InterlockedDecrement
InterlockedIncrement
VirtualQuery
WideCharToMultiByte
MultiByteToWideChar
lstrlenA
lstrcpynA
LoadLibraryExA
GetThreadLocale
GetStartupInfoA
GetProcAddress
GetModuleHandleA
GetModuleFileNameA
GetLocaleInfoA
GetCommandLineA
FreeLibrary
FindFirstFileA
FindClose
ExitProcess
WriteFile
UnhandledExceptionFilter
RtlUnwind
RaiseException
GetStdHandle
user32.dll
GetKeyboardType
LoadStringA
MessageBoxA
CharNextA
advapi32.dll
RegQueryValueExA
RegOpenKeyExA
RegCloseKey
oleaut32.dll
SysFreeString
SysReAllocStringLen
SysAllocStringLen
kernel32.dll
TlsSetValue
TlsGetValue
LocalAlloc
GetModuleHandleA
advapi32.dll
RegSetValueExA
RegQueryValueExA
RegOpenKeyExA
RegCreateKeyExA
RegCloseKey
kernel32.dll
lstrcpyA
WriteFile
WaitForSingleObject
VirtualQuery
VirtualAlloc
SizeofResource
SetThreadLocale
SetFilePointer
SetEvent
SetErrorMode
SetEndOfFile
SearchPathA
ResetEvent
ReleaseMutex
ReadFile
OpenFileMappingA
MultiByteToWideChar
MulDiv
MoveFileA
LockResource
LoadResource
LoadLibraryA
LeaveCriticalSection
IsDBCSLeadByte
InitializeCriticalSection
GlobalUnlock
GlobalReAlloc
GlobalMemoryStatus
GlobalHandle
GlobalLock
GlobalFree
GlobalFindAtomA
GlobalDeleteAtom
GlobalAlloc
GlobalAddAtomA
GetVersionExA
GetVersion
GetTickCount
GetThreadLocale
GetSystemInfo
GetSystemDefaultLangID
GetStringTypeExA
GetStdHandle
GetProcAddress
GetModuleHandleA
GetModuleFileNameA
GetLocaleInfoA
GetLocalTime
GetLastError
GetFullPathNameA
GetFileAttributesA
GetDiskFreeSpaceA
GetDateFormatA
GetCurrentThreadId
GetCurrentProcessId
GetCurrentDirectoryA
GetCPInfo
GetACP
FreeResource
InterlockedIncrement
InterlockedExchange
InterlockedDecrement
FreeLibrary
FormatMessageA
FindResourceA
FindFirstFileA
FindClose
FileTimeToLocalFileTime
FileTimeToDosDateTime
FatalAppExitA
EnumCalendarInfoA
EnterCriticalSection
DeleteFileA
DeleteCriticalSection
CreateThread
CreateMutexA
CreateFileA
CreateEventA
CreateDirectoryA
CompareStringA
CloseHandle
version.dll
VerQueryValueA
GetFileVersionInfoSizeA
GetFileVersionInfoA
gdi32.dll
UnrealizeObject
StretchBlt
SetWindowOrgEx
SetWindowExtEx
SetWinMetaFileBits
SetViewportOrgEx
SetViewportExtEx
SetTextColor
SetStretchBltMode
SetROP2
SetPixel
SetMapMode
SetEnhMetaFileBits
SetDIBColorTable
SetBrushOrgEx
SetBkMode
SetBkColor
SelectPalette
SelectObject
SelectClipRgn
SaveDC
RestoreDC
Rectangle
RectVisible
RealizePalette
PolyPolyline
PlayEnhMetaFile
PatBlt
MoveToEx
MaskBlt
LineTo
IntersectClipRect
GetWindowOrgEx
GetWinMetaFileBits
GetTextMetricsA
GetTextExtentPointA
GetTextExtentPoint32A
GetSystemPaletteEntries
GetStockObject
GetPixel
GetPaletteEntries
GetObjectA
GetNearestColor
GetEnhMetaFilePaletteEntries
GetEnhMetaFileHeader
GetEnhMetaFileBits
GetDeviceCaps
GetDIBits
GetDIBColorTable
GetDCOrgEx
GetCurrentPositionEx
GetClipBox
GetBrushOrgEx
GetBitmapBits
ExtTextOutA
ExtCreatePen
ExcludeClipRect
DeleteObject
DeleteEnhMetaFile
DeleteDC
CreateSolidBrush
CreatePenIndirect
CreatePalette
CreateHalftonePalette
CreateFontIndirectA
CreateDIBitmap
CreateDIBSection
CreateCompatibleDC
CreateCompatibleBitmap
CreateBrushIndirect
CreateBitmap
CopyEnhMetaFileA
BitBlt
user32.dll
CreateWindowExA
WindowFromPoint
WinHelpA
WaitMessage
ValidateRect
UpdateWindow
UnregisterClassA
UnionRect
UnhookWindowsHookEx
TranslateMessage
TranslateMDISysAccel
TrackPopupMenu
SystemParametersInfoA
ShowWindow
ShowScrollBar
ShowOwnedPopups
ShowCursor
SetWindowsHookExA
SetWindowTextA
SetWindowPos
SetWindowPlacement
SetWindowLongA
SetTimer
SetScrollRange
SetScrollPos
SetScrollInfo
SetRect
SetPropA
SetParent
SetMenuItemInfoA
SetMenu
SetKeyboardState
SetForegroundWindow
SetFocus
SetCursor
SetClipboardData
SetClassLongA
SetCapture
SetActiveWindow
SendMessageA
ScrollWindowEx
ScrollWindow
ScreenToClient
RemovePropA
RemoveMenu
ReleaseDC
ReleaseCapture
RegisterWindowMessageA
RegisterClipboardFormatA
RegisterClassA
RedrawWindow
PtInRect
PostQuitMessage
PostMessageA
PeekMessageA
OpenClipboard
OffsetRect
OemToCharBuffA
OemToCharA
MessageBoxA
MessageBeep
MapWindowPoints
MapVirtualKeyA
LoadStringA
LoadKeyboardLayoutA
LoadIconA
LoadCursorA
LoadBitmapA
KillTimer
IsZoomed
IsWindowVisible
IsWindowEnabled
IsWindow
IsRectEmpty
IsIconic
IsDialogMessageA
IsChild
IsCharAlphaNumericA
IsCharAlphaA
InvalidateRect
IntersectRect
InsertMenuItemA
InsertMenuA
InflateRect
GetWindowThreadProcessId
GetWindowTextA
GetWindowRect
GetWindowPlacement
GetWindowLongA
GetWindowDC
GetTopWindow
GetSystemMetrics
GetSystemMenu
GetSysColorBrush
GetSysColor
GetSubMenu
GetScrollRange
GetScrollPos
GetScrollInfo
GetPropA
GetParent
GetWindow
GetMessageTime
GetMenuStringA
GetMenuState
GetMenuItemInfoA
GetMenuItemID
GetMenuItemCount
GetMenu
GetLastActivePopup
GetKeyboardState
GetKeyboardLayoutList
GetKeyboardLayout
GetKeyState
GetKeyNameTextA
GetIconInfo
GetForegroundWindow
GetFocus
GetDoubleClickTime
GetDesktopWindow
GetDCEx
GetCursorPos
GetCursor
GetClipboardData
GetClientRect
GetClassNameA
GetClassInfoA
GetCaretPos
GetCapture
GetActiveWindow
FrameRect
FindWindowA
FillRect
EqualRect
EnumWindows
EnumThreadWindows
EnumClipboardFormats
EndPaint
EnableWindow
EnableScrollBar
EnableMenuItem
EmptyClipboard
DrawTextA
DrawMenuBar
DrawIconEx
DrawIcon
DrawFrameControl
DrawFocusRect
DrawEdge
DispatchMessageA
DestroyWindow
DestroyMenu
DestroyIcon
DestroyCursor
DeleteMenu
DefWindowProcA
DefMDIChildProcA
DefFrameProcA
CreatePopupMenu
CreateMenu
CreateIcon
CloseClipboard
ClientToScreen
CheckMenuItem
CallWindowProcA
CallNextHookEx
BeginPaint
CharNextA
CharLowerBuffA
CharLowerA
CharUpperBuffA
CharToOemBuffA
CharToOemA
AdjustWindowRectEx
ActivateKeyboardLayout
kernel32.dll
oleaut32.dll
SafeArrayPtrOfIndex
SafeArrayPutElement
SafeArrayGetElement
SafeArrayUnaccessData
SafeArrayAccessData
SafeArrayGetUBound
SafeArrayGetLBound
SafeArrayCreate
VariantChangeType
VariantCopyInd
VariantCopy
VariantClear
VariantInit
ole32.dll
OleInitialize
CLSIDFromProgID
CoCreateInstance
CoGetClassObject
CoUninitialize
CoInitialize
oleaut32.dll
GetErrorInfo
SysFreeString
comctl32.dll
ImageList_SetIconSize
ImageList_GetIconSize
ImageList_Write
ImageList_Read
ImageList_GetDragImage
ImageList_DragShowNolock
ImageList_SetDragCursorImage
ImageList_DragMove
ImageList_DragLeave
ImageList_DragEnter
ImageList_EndDrag
ImageList_BeginDrag
ImageList_Remove
ImageList_DrawEx
ImageList_Draw
ImageList_GetBkColor
ImageList_SetBkColor
ImageList_ReplaceIcon
ImageList_Add
ImageList_GetImageCount
ImageList_Destroy
ImageList_Create
InitCommonControls
kernel32.dll
MulDiv
0(0<0T0l0
1$1D1P1T1X1\1`1d1h1l1x1
282@2D2H2L2P2T2X2\2`2x2
3"3*323:3B3J3R3Z3b3j3r3z3
4&4.464?4`4h4
798m8y8
;!;';5;H;R;X;f;l;t;
<$</<@<F<N<X<o<z<
???E?^?g?p?{?
0>1D1T1]1
1.2X2r2
3&3P3V3h3
4&4.444:4l4
415<5E5K5[5d5
7]7c7k7
&1e1u1
7"767j7
7 8)8[8d8
9!:(:H:
:/<W<^<v<
= =k=~=
?%?3?N?c?m?r?
60?0e0r0
3&3*30343:3A3E3_3h3q3}3
3&4P4^4c4|4
7"7*727:7B7J7R7Z7b7j7r7z7
8"8*828:8B8J8R8Z8b8j8r8z8
9"9*929:9B9J9R9Z9b9j9r9z9
:":*:2:::B:J:R:Z:b:j:r:z:
;";*;2;:;B;J;R;Z;b;j;r;z;
<"<*<2<:<B<J<R<Z<b<j<r<z<
="=*=2=:=B=J=R=Z=b=j=r=z=
>">*>2>:>B>J>R>Z>b>j>r>z>
?"?*?2?:?B?J?R?Z?b?j?r?z?
0"0*020:0B0J0R0Z0b0j0r0z0
1"1*121:1B1J1R1Z1b1j1r1*2
4 4(40484@4H4P4X4`4h4p4x4
5 5(50585@5H5P5X5`5h5p5x5
6 6(60686@6H6P6X6`6h6p6x6
7 7(70787@7H7P7X7`7o7{7
8'8+8<8\8d8h8l8p8t8x8|8
9 9$9(9,90949H9h9p9t9x9|9
: :$:(:,:0:4:8:<:@:X:x:
;(;0;4;8;<;@;D;H;L;P;`;
<4<<<@<D<H<L<P<T<X<\<l<
=<=D=H=L=P=T=X=\=`=d=t=
>,>L>T>X>\>`>d>h>l>p>t>
? ?$?(?,?0?@?`?h?l?p?t?x?|?
0 0$0(0,0004080<0P0p0x0|0
1,14181<1@1D1H1L1P1T1h1
2 2-252D2Q2Y2t2
3 3$3(3,3D3P3T3p3x3|3
<#<i<q<
3A5E5I5M5Q5U5Y5]5a5e5i5m5q5u5y5}5
9!9)919
4.5I5d5
8O:6;l;
A0h0|0
303c3w3
4#444D4Z4f4
9M9R9`9
;K;c;u;
<%=7=N=`=	>q>
2,2V2j2
474F4_4z4
6!7<7E7
:;:C:Q:
;,<F<U<
>@>O>^>z>
?#?.?6???K?Q?Y?b?n?s?|?
0&0.0N0
8 8*8<8Q8\8a8f8s8
:/:B:K:f:y:
;%;C;e;t;
>*>@>x>
>B?I?\?h?m?{?
00T0c0
6.6H6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7X7\7d7h7p7t7|7
8$8(80848<8@8H8L8T8X8`8d8l8p8x8|8
9 9$9,909?9K9V9j9u9
:':2:<:F:P:Z:d:n:x:
;:;B;J;R;Z;
<*<`<m<
=8=E=n=
0#0(03090>0I0O0T0_0e0j0u0{0
1%1+101;1A1F1Q1W1\1g1m1r1}1
2#3/3<3N3~3
4 4$4(4,404H4`4d4x4
5,585<5X5`5d5h5l5p5t5x5|5
6 6$6(6,60646P6p6x6|6
787@7D7H7L7P7T7X7\7`7|7
8 8$8(8D8d8l8p8t8x8|8
949<9@9D9H9L9P9T9X9\9x9
: :$:(:D:d:l:p:t:x:|:
;';6;M;
<&<=<]<k<z<
=%=M=[=j=
=5>D>e>t>
?#?2?F?U?f?
:!;H;m;
<R<~<M=Q=U=Y=]=a=e=i=m=q=u=y=}=
0>0W0o0
1#1'1+1/13171;1?1C1G1K1O1S1c1
1#3'3+3/33373;3?3C3G3K3O3S3W3[3_3c3g3k3o3s3w3
>#>'>+>/>3>7>;>
1	2F2[2p2
2h3l3p3t3x3|3
869Z:^:b:f:j:n:r:v:z:~:
=,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
0#0'0+0/03070;0?0C0G0K0y1
9)9a9z9
:I:e:i:m:q:u:y:}:
=!=%=)=-=1=5=9===A=E=I=M=!?
0E0^0u0
4!4%4)4-4145494=4A4E4I4M4Q4U4Y4]4a4e4i4=6
4!4%4)4-4#5'5+5/53575;5?5C5G5K5O5W5
=!=>=j=
>9>A>\>^?
0!0%0)0-01050
122F2t2
7.8E8X8j8
162E2S2
2@3D3H3L3P3T3X3\3`3d3h3l3
5+545G5
6(8E8V8t8
;;;J;Z;e;u;
<6<H<W<u<z<
5;5J5W5b5u5
7!7'7,71777>7D7K7Q7X7^7e7k7r7
8"8*828:8S8_8l8~8
9 9$9(9,9<9\9d9h9l9p9t9x9|9
:,:4:8:<:@:D:H:L:P:T:/;_;
>)>.>9>>>I>
3	3?3F3
4:4A4l4s4
5J5_5r5
7!7%7)7-717
8'8/858?8H8Q8[8h8s8
9$9,949<9D9L9T9\9d9l9t9|9
:':4:F:}:
; ;$;(;,;0;4;8;<;@;D;H;L;h;
<-=1=5=9===A=E=I=M=Q=U=Y=]=a=e=i=m=q=u=
0#0'0+0/03070;0?0C0G0
3?3X3b3i3
3H4]4	5
070;0?0C0G0K0
0'333:3D3O3a3r3x3
545Y5`5
6<6D6H6L6P6T6X6\6`6d6x6
7(7H7P7T7X7\7`7d7h7l7p7
8 848T8\8`8d8h8l8p8t8x8|8
9 9$9(9,909@9`9h9l9p9t9x9|9
:$:(:,:0:4:8:<:@:D:X:x:
;<;D;H;L;P;T;X;\;`;d;t;
<&<*<<<M<Q<
=<=W=[=l=|=
>$>0>4>@>D>L>P>T>X>\>`>d>h>l>p>t>x>|>
? ?$?(?,?0?4?8?<?@?D?H?L?P?T?X?\?`?d?h?p?
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|0
1,1<1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2!242T2\2`2d2h2l2p2t2x2|2
3<3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4,44484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4
646<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7\7h7|7
8 8$8(8,8084888<8@8D8H8V8h8
8V9Z9^9b9f9j9n9
: :$:(:6:`:d:h:l:p:t:x:|:
;0;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;
< <(<<<N<R<d<
=4=<=@=D=H=L=P=T=X=\=l=
8'8,8k8x8
9'949A9S9X9v9
:<:D:H:L:P:T:X:\:`:d:
:3;8;c;r;
;Z<d<n<w<
<#=H=X=w=
?-?:?N?U?o?
8$9P9|9
<H=Z=w=
> >U>o>
859]:d:
=;=K=k=
3 4,4@4H4L4P4T4X4\4`4d4h4l4z4
9-999H9
90:5:T:e:
<!=&=Q=m=
:!:[:i:w:
1 1$1(1,1014181<1@1D1H1
;#;';+;/;3;7;;;?;C;G;K;O;S;W;[;_;Z<
>-?L?\?i?
#050<0j0
1"1&1*1.12161:1>1B1F1J1N1R1V1Z1^1b1f1j1n1r1
9	: :<:P:
<'<B<]<
Y0I1[1
5"5&5*5.52565:5>5B5F5J5N5
>6?:?>?B?F?J?N?R?V?Z?^?b?f?j?n?r?v?z?
0B0F0J0N0R0V0Z0^0
2(252L2\2
2"3O3V3r3
596C6S6Y6m6w6
7#737|7
8+808b879
;+;7;D;P;c;o;y;
;%<3<=<V<^<f<n<v<~<
=#=0=B=O=[=h=z=
>">/>;>H>Z>g>s>
? ?(?0?8?@?H?P?X?`?h?p?x?
0 0(00080@0H0P0X0`0h0p0x0
1 1(10181@1H1P1X1`1h1p1x1
2 2$2(2,2024282<2@2T2t2|2
3,3E3|3
445D5P5T5\5`5d5h5l5p5t5x5|5
6$6(6064686<6@6D6H6L6P6T6X6\6j6v6
7"7&7*7B7F7J7a7e7i7
8#8+8B8F8J8b8f8j8
9%9)9-9H9X9h9p9t9x9|9
:!:8:@:X:u:
;#;+;n;r;v;z;~;
< <$<(<,<0<4<8<<<@<D<H<L<P<X<h<v<z<
= =$=(=,=0=4=8=<=@=D=H=L=P=^=l=p=
>$>,>0>4>8><>@>D>H>L>P>d>t>
? ?/?3?D?d?l?p?t?x?|?
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0h0u0y0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
=&>C>[>l>
?&?8?|?
2&3C3[3l3
6'6?6P6b6
A0]0d0
2$252A2M2a2o2~2
=!>m>$?
080X0{022~2
5=6M6d6t6
6$767S7
81898D8d8l8p8t8x8|8
9#919:9G9U9^9k9
:9;X;x;
=#=*=4=>=C=U>m>
>C?S?j?
0&1]1{1
3)3C4x4
 000@0H0L0P0T0X0\0`0d0h0l0p0t0x0|0
1%1K1P1x1
8,9:9p9x:@;^;
>9?K?X?
<N<]<b<z<
=$>U>e>d?
0&050?0I0S0]0g0r0|0
1/191D1N1Y1c1j1t1{1
2,24282<2@2D2H2L2P2T2X2\2`2d2t2
3 3$3(3,303
5 5&5?5]5h5v5
5B6J6P6\6d6
6g7o7u7
8'8c8n8
879B9b9
<,<><S<_<l<~<
=,=E=h=
> >$>(>D>P>d>l>p>t>x>|>
>;???C?G?K?O?S?W?[?_?c?g?k?o?s?
0(00080@0h0t0~0
1-2B2k2
7@8f8m8
;;<G<O<Y<f<v<
=*=/===F=K=P=^=g=l=q=
>$>->2>c?o?|?
0 0(0,0004080<0@0D0H0L0P0
1(1:1D1Q1]1f1l1y1
2%2,232:2A2H2O2V2]2d2k2r2y2
3$323G3T3Y3f3k3x3}3
4,414>4C4P4U4b4g4t4y4
5(5-5:5?5L5Q5^5c5p5u5
6$6)666;6H6M6Z6_6l6q6~6
6f:o:y:
;.;;;G;T;f;s;
< <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
=&=?=G=e=
>'>H>P>j>r>
? ?(?,?B?N?d?
 0D0j0
0(181D1H1P1T1X1\1`1d1h1l1p1t1x1|1
2"2a2k2
9X9g9~9
:$:,:4:<:D:L:T:\:d:l:t:|:
;$;,;4;<;D;L;T;`;d;h;l;p;t;x;|;
< <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
="=*=4=?=D=P=X=`=h=p=x=
> >$>(>,><>L>P>s>
0_0f0}0
2"3,363;3N3p3}3
4!4&41484k4w4
626:6D6_6k6x6
7#7*757G7Z7{7
8+878D8V8\8
:$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
;:;>;B;F;J;N;R;V;Z;^;b;f;|;
< <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
=6=:=>=B=X={=
>(>0>G>O>m>q>u>
?&?.?K?S?i?q?
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
3&3*3;3C3`3h3
434V4y4
5"5*5F5o5w5
60686<6S6[6s6{6
7%7-7H7P7T7j7
8%8J8o8
:):O:t:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<+<3<7<M<U<s<
='=E=I=M=c=g=k=
>8>@>W>_>c>z>~>
?/?T?x?
0+0O0u0
1j1r1|1
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
9$:3:	=9=d=
>&>5>h>
7T8[8c9
(1i1g2
<G=S=[=c=o=w=
5"5&5*5.52565:5>5B5F5J5N5R5V5Z5^5b5f5j5n5r5v5z5~5
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
;%;);<;L;\;d;h;l;p;t;x;|;
< <$<(<,<0<4<8<<<@<D<H<L<P<`<o<s<
=+=3=Q=Y=]=q=y=
>!>)>->@>D>k>
?.?6?R?Z?^?u?y?}?
'0L0q0
1(1J1k1
2)2O2t2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5	5!5)5E5M5Q5g5
777?7\7d7
8"8;8C8G8]8e8
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<"<&<*<.<2<6<:<L<]<a<r<z<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
>7>Z>b>
?6?>?Y?a?e?y?
0*060L0T0X0k0s0
1 1I1Q1o1w1
2.262Q2Y2]2t2x2|2
3)3?3h3
5:6>6F6L6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
989<9@9D9H9L9P9T9X9\9`9d9h9|9
:$:(:4:8:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
< <(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=t=
>1>9>V>^>z>
?'?/?3?G?O?m?u?y?
 0,0B0J0N0a0
1;1C1a1i1
2$2=2A2E2`2h2
3,3U3z3
424V4x4
5,5O5u5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7
8(8,84888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9>9B9F9J9N9R9V9Z9h9u9y9
:3:;:Y:a:{:
;';M;v;~;
<.<6<P<X<\<r<z<
=*=N=r=
= >F>l>
? ?$?(?,?0?4?8?<?@?D?H?L?P?T?X?\?`?d?h?l?p?t?x?|?
0 02060G0O0h0p0
1!151=1[1c1g1{1
2'2P2X2v2~2
3135393T3\3v3~3
4+4P4u4
5$5I5k5
6N7R7V7\7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
969:9>9B9F9J9N9R9V9Z9^9b9f9j9n9r9v9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;0;>;B;S;[;s;
<	<&<.<J<R<o<{<
= =(=,=@=e=
>7>Y>a>
?<?D?b?j?
0%0>0B0F0a0i0
282\2~2
323X3~3
4<4L4X4\4d4h4l4p4t4x4|4
5 5$5(5,5054585<5@5D5H5L5Z5^5b5f5|5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
727:7>7T7w7
8-858S8W8[8_8u8}8
9&929H9P9o9w9{9
:+:3:O:W:w:
;';3;I;r;
<)<O<u<
= =(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
>,>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
0(000p0{0
5+6\6k6
7A7K7U7
0 0$0(0+1
0-1V1f1
4@6H7`7
?%?<?u?
 0L0%1B1
3'313l3
;!<]=k=y=
>$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
>3???L?^?d?
0 0$0(0,0004080<0T0p0
0$1^1i1t1
2+272P2v2
5F5N5l5z5
</<;<E<O<T<c<u<
=4=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
> >$>(>,>H>d>h>|>
?(?0?4?8?<?@?D?H?L?P?T?X?\?`?d?h?l?p?t?x?|?
000E0I0\0|0
1 1$1(1,1014181<1@1D1H1L1P1T1X1l1
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2t2
2	3<3T3p3
4$444<4@4D4H4L4P4T4X4\4`4d4h4l4p4
6 6_6c6g6l6
7#7'7+707}7
7$8(8,80848
9#9'9,9
9Z:^:j:p:
:Z;^;b;f;j;p;
;\<`<h<l<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
=R>V>Z>^>b>f>j>n>r>v>z>~>
?"?&?*?.?2?6?:?>?B?F?J?N?R?V?Z?^?b?f?j?n?r?v?z?
0)010J0V0i0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
1H2X2t2
313\3x3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
6"6&6*6.62666:6>6B6F6J6N6R6V6Z6^6b6f6j6n6r6v6z6~6
7"7&7*7.72767:7>7B7F7J7N7`7q7u7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8h8|8
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :$:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;:;>;B;F;X;i;m;
< <4<8<L<\<l<t<x<|<
=2=6=:=T=v=~=
>&>L>T>l>
>`?d?h?l?p?t?x?|?
0 0$0(0,0<0\0d0h0l0p0t0x0|0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2 20282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
3 3$3(3,3034383<3@3D3H3L3P3t3
4&454=4X4^4
8 8$8(8,8084888
061Q1d1n1
1)2;2F2
3Q3c3l3
4!4*434N4
5!5:5C5K5Y5^5h5w5
6<6I6]6g6
7(7O7X7a7
9.969G9e9
;$;4;=;f;r;
<,<I<X<{<
=3===G=P=c=h=t=z=
3E3X3x3
3(4Q4v4
7'7;7l7
3(3.3w3
<*<B<^<g<
4!9X9c9q9
$0/0=0
;);];x;
=;>?>C>G>K>O>S>W>
0B1F1J1N1R1V1Z1^1
1%2c2g2k2o2s2w2{2
4&505~5
5R7Z7e7
r0Y3d3
4F5Q5p5
606;6R6r6
0)0@1m1
4E4W4=5|5
=f>v>B?_?
H1X1y1
5+5C5T5l5
5#6-676A6K6U6
8$8*868@8F8R8W8b8g8l8w8|8
9,9>:O:c:
;';6;@;I;U;^;j;s;
<+<4<T<a<k<|<
>'>3>K>U>_>j>o>z>
? ?$?(?,?0?4?8?<?@?N?`?d?h?l?
0 0$0(0,0004080<0@0D0H0L0P0T0b0f0j0n0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2v2~2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
9$989L9`9t9
1#1(13181D1`1d1l1p1t1x1|1
2,2H2X2d2h2p2t2x2|2
8F8V8c8s8
9"9E9U9
9O:h:w:
4#4R4b4y4
9"929>9\9f9m9
=D=`=l=
> >$>(>,>0>D>P>T>`>d>l>p>t>x>|>
?(?7?;?I?M?Q?j?
0	0!0)0-0C0K0O0e0m0
1(1;1C1G1`1h1
2=2h2t2x2
3'3+393\3l3|3
474;4?4c4k4
5<5Z5|5
5$696@6P6`6h6l6p6t6x6|6
6"7&7*7H7L7P7t7
8*828N8V8w8
9 9$9(9,9094989<9@9P9p9x9|9
;*<X<k<~<
<I=\=t=
5"646@6L6X6
9K<[=}=a>
?$?B?T?
0+080G0V0e0
142S2F3T3k3
6A6J6o6
;#<(<`<R>r>
6N7d7p7
8#8<8r8
9.9H9^9
<8=B=L=i=&>?>
?G?l?p?t?x?|?
0 0*040?0I0[0n0v0
1.1T1d1t1|1
2.2:2R2s2{2
3$3<3D3`3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5"5&5*5.525L5f5j5x5
506K6X6k6
7&7\7o7t7
8.8d8~8
8-91989s9w9|9
: :$:0:4:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;^;f;n;
<"<&<*<.<2<6<:<><B<F<J<N<R<V<Z<^<b<f<j<n<r<v<z<~<
=(=8=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
> >$>(>,>0>4>8><>@>D>H>L>P>T>`>k>o>}>
?5?=?A?W?_?c?|?
04080<0@0V0Z0^0b0}0
1&1D1L1P1d1l1
2+2A2I2f2n2r2
3!343@3Y3a3e3x3
4#4'4?4G4K4b4n4
5!5=5E5I5_5g5k5
6!676C6Y6e6
7+7C7O7j7
7"8J8V8k8
9)9C9O9g9
:':L:X:m:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
< <$<(<,<@<U<Y<g<k<o<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=n=
> >$>(>,>0>4>8>F>N>V>^>f>n>
?%?/?E?k?u?
577i7`8E:I:M:Q:U:Y:]:a:e:
=%>S>0?
6*6=7L7w7
5E6b6q6
6l70878
:!:7:c:
0"1P1d1
4-4<4u5
8&8Q8c8
9A9Y9l9~9
:/;3;7;;;?;C;G;c;
<[=f=~=
= >;>M>g>
1)111@1T1b1j1y1
2<3F3`3
=!>/>N?
.0@0U0j0|0
3*3A3l3
:0;X;g;
<M<Z<w<
>6>X>]>w>
8%9a9j9o9x9
: :2:T:d:t:+;7;c;o;{;
0.0:0.161G1S1]1F2L2W2v384<4@4D4H4L4P4q6
8$8.8`8
9)929:9G9M9U9f9o9z9
9J:V:_:d:p:y:
;,<1<=<P<U<b<
<>=V=e=r=w=
021J1m1
2L3P3T3X3\3`3d3h3l3p3t3x3|3
;I;C<O<
B0W0z0
8=8E8S8s8
3!3)343F3V3^3m3w3|3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4t4x4|4
717E7a7
8,84888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9,9094989<9@9D9H9\9n9r9
9#:.:_:
<	='=9=
5 5*5/595@5`5u5
6 6(6,64686@6D6L6P6X6\6d6h6w6
0;1G1T1f1
2$2,242<2D2L2T2\2d2l2t2|2
3$3,343<3D3L3T3\3d3l3t3|3
4&4,4L4T4X4\4`4d4h4l4p4t4x4|4
5 5$5(5,5054585<5T5k5o5
6)616J6R6j6r6
?0?H?k?
1*191P1
3&3O3[3b3t3
4$4(4,4044484<4@4D4`4
5$545<5@5D5H5L5P5T5X5\5`5d5h5x5
6-61656e6
?4?\?s?
%010k0
6 696I6d6
:B;P;j;
>`>d>h>l>p>t>x>|>
4"4+4G4
6@6L6`6h6l6p6t6x6|6
:':>:m:
=">K>W>^>p>
?(?<?D?H?L?P?T?X?\?`?d?r?
1b2f2j2n2t2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4 4$424H4X4\4g4
5 5$505N5
6$63676B6J6g6k6o6s6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7t7
8 8,808@8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9+9/939P9T9X9q9y9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<$<4<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
= =,=E=
=$>9>@>i>p>
?'?L?j?r?|?
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|0
1"1*121:1B1J1R1Z1b1t1x1|1
3>3B3F3^3
4-454S4t4
5'5K5o5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
:&:<:O:S:^:f:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<#<.<6<Q<Y<t<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
?$?(?3?V?|?
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2#2'242D2T2\2`2d2h2l2p2t2x2|2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3l3}3
4,4<4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5 5$5(5,5054585<5@5D5X5l5p5{5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7#7.767X7d7h7x7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9$9(989@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :$:(:,:0:4:8:<:@:N:l:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<(<,<8<H<X<`<d<h<l<p<t<x<|<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=p=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
?,?4?8?<?@?D?H?L?P?T?X?\?`?d?h?l?p?t?x?|?
0 0$0(0,00040D0U0Y0d0t0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
3"3=3E3`3h3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5.525=5E5`5h5
6,64686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787H7X7\7g7k7o7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9/9X9h9x9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<$<6<:<E<l<|<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
?%?)?4?D?T?\?`?d?h?l?p?t?x?|?
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0|0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2(2=2A2L2y2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5 545I5M5X5h5x5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7
8 8,80888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:
<(<><B<M<U<x<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=p=
>$>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>z>
>%?D?H?L?h?
0 0,090=0H0l0
0+1/13181T1
4 4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
<:<I<X<
4B5f5$6q6
;#;F;_;
4$565_5
:b;k;y;
7F7J7m7
<;=Y=u=
0#1R1{1
5	636_6
3*4Q4G5W5
;*;w;f<
536Z6y6
8[9|9+:9:
02161>1U1
2m2'3=3s3_4}4
8&9\9y9
4$5+5D5
7w8f;#<J<t<
<#=J=v=
343B3h3
839T9[9
;*;1;[;_;c;g;k;o;s;w;{;
?!?%?)?-?1?5?9?=?A?E?U?
2=2K2h2
9$:P:|:
:\;`;d;h;l;p;t;x;|;
>3>B>L?
#0K0O0
5#5?5d5
6W7~7i8
:9:=:A:E:I:M:Q:
;D>H>L>P>T>X>\>`>d>h>l>
6e6<9J9f9
;";&;*;.;2;6;:;R;n;|;
;3<?<F<P<Z<e<w<
=4=<=@=D=H=L=P=T=X=\=p=|=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
?,?A?E?T?d?t?|?
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|0
121:1W1_1|1
232;2V2^2b2v2~2
3'333I3Q3l3t3x3
4$4B4J4h4p4
5	5$5,505G5K5O5j5r5
707U7w7
0>1j1(2
7$7(7,7074787<7@7D7`7p7|7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 919X9m9t9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<,<I?w?
2!2*282
<!<J<Z<|<
2 2$2(2s3w3{3
8X:s:U;
O0[0h0z0
1 1(10181@1H1P1X1`1h1p1x1
2 2(20282@2H2P2X2`2h2p2
3(3034383<3@3D3H3L3P3l3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4x4
5,5@5D5X5h5x5
6$6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,707D7V7Z7l7|7
8$848D8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9,9094989<9@9D9H9L9`9r9v9
: :$:(:,:0:D:d:l:p:t:x:|:
;4;<;@;D;H;L;P;T;X;\;
<6===_=f=
5J5f5m5
7%8:8e8v8
9<9J9X9f9t9
;+;@;U;j;
;.<T<[<r<
5\647=7
9P9W9y9
>3>?>L>^>k>r>
6 6&6,62686>6D6J6P6V6\6b6h6n6t6z6
7"7(7.747:7@7F7L7R7X7^7d7j7p7v7|7
8$8*80868<8B8H8N8T8Z8`8f8l8r8x8~8
9 9&9,92989>9D9J9P9V9\9b9h9n9t9z9
:":(:.:4:::@:F:L:R:X:^:d:j:p:v:|:
;$;*;0;6;<;B;H;N;T;Z;`;f;l;r;x;~;
< <&<,<2<8<><D<J<P<V<\<b<h<n<t<z<
="=(=.=4=:=@=F=L=R=X=^=d=j=p=v=|=
>$>*>0>6><>B>H>N>T>Z>`>f>l>r>x>~>
? ?&?,?2?8?>?D?J?P?V?\?b?h?n?t?z?
0"0(0.040:0@0F0L0R0X0^0d0j0p0v0|0
1$1*10161<1B1H1N1T1Z1`1f1l1r1x1~1
2 2&2,22282>2D2J2P2V2\2b2h2n2t2z2
3"3(3.343:3@3F3L3R3X3^3d3j3p3v3|3
4$4*40464<4B4H4N4T4Z4`4f4l4r4x4~4
5 5&5,52585>5D5J5P5V5\5b5h5n5t5z5
6"6(6.646:6@6F6L6R6X6^6d6j6p6v6|6
7"7&7*7.72767:7>7B7F7J7N7R7V7Z7^7b7f7j7n7r7v7z7~7
8"8&8*8.82868:8>8B8F8J8N8R8V8Z8^8b8f8j8n8r8v8z8~8
9"9&9*9.92969:9>9B9F9J9N9R9V9Z9^9b9f9j9n9r9v9z9~9
:":&:*:.:2:6:::>:B:F:J:N:R:V:Z:^:b:f:j:n:r:v:z:~:
;";&;*;.;2;6;:;>;B;F;J;N;R;V;Z;^;b;f;j;n;r;v;z;~;
<"<&<*<.<2<6<:<><B<F<J<N<R<V<Z<^<b<f<j<n<r<v<z<~<
="=&=*=.=2=6=:=>=B=F=J=N=R=V=Z=^=b=f=j=n=r=v=z=~=
>">&>*>.>2>6>:>>>B>F>J>N>R>V>Z>^>b>f>j>n>r>v>z>~>
?"?&?*?.?2?6?:?>?B?F?J?N?R?V?Z?^?b?f?j?n?r?v?z?~?
0"0&0*0.02060:0>0B0F0J0N0R0V0Z0^0b0f0j0n0r0v0z0~0
1"1&1*1.12161:1>1B1F1J1N1R1V1Z1^1b1f1j1n1r1v1z1~1
4*424<4M4Z4|4
6K7]788=8[8t8
;K;W;d;v;|;
<"<8<D<X<`<d<h<l<p<t<x<|<
>2>B>Y>i>
?3?d?{?
0)0=0R0{0<2
:c;~;`<
8)<r<(=
>)?I?V?{?
3X4W5w5
676P6p6
9):A:}:
<1<5<9<=<A<E<N<
"0]0|0
606L6j6
6	7>7Z7
9H:\:p:
;$;8;H;X;h;x;
?(?:?@?H?P?X?`?h?p?x?
0#000B0H0h0p0t0x0|0
1 1(1,1014181<1@1D1H1V1h1
2 2Y2]2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3n3v3~3
4044484U4Y4]4z4
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7$7C7G7K7h7p7
8#8+8F8N8l8
999\9l9|9
:,:<:L:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
< <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
=;=d=l=
= >E>l>
?$?K?q?
1#1C1l1|1
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4 4$484J4N4_4
5 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7z7
8+8N8v8~8
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<%<B<g<
="=D=P=d=l=p=t=x=|=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>
>)?H?n?
0C0P0-1H1g1t1
5D5]506p6
7"7h7q7
?<?H?X?
3)3D3l3
4V4e4|4
5	6,666
=1>G>Z>r>
2:2f2|2
3!323U3
4!4b4z4
5	6,6E6i6~6
:$:Z:o:
=-=>=F=K=[=`=j=z=
>%><>S>X>}>
<,<I<e<
3$3	4,4<4V4o4
5 5F5n5
=$>3>r>
1%2K2Y2\6
2B3i3y3
5!6F6{6
6T7k7V8
<#=f=q=
=i>m>w>
5u6]7z7
=t=%>L>
4'434:4D4N4Z4_4q4~4
505P5X5\5`5d5h5l5p5t5x5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
767I7\7r7v7z7
93:_:k:x:
; ;$;(;,;0;4;8;<;@;X;v;~;
<4<F<Z<i<x<
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<"<*<5<:<D<d<l<p<t<x<|<
> >$>(>,>:>B>J>R>l>
?#?+?F?N?e?m?
0 0$0,0@0U0Y0l0x0|0
;7<_<t<
171C1J2
4%454%5
:+:L:~:
;,;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
<$<0<4<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>p>
? ?4?<?@?D?H?L?P?T?X?\?`?n?
0 0$080D0X0`0d0h0l0p0t0x0|0
1$1(1,1014181<1@1D1T1`1t1|1
2o3x3\5W6`6
6>7G7699:B:
83L7[7
7A8P8d8s8
9(:4:8:H:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
< <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
=#>=>I>S>
0"1l1{1
2Z2r2{2u3
6/7B7[7q7
7<8S8x869
;D<|<+=
0*0`0y0
1+1M1k1
2 282I2X2
3.3;3U3i3x3
3/4>4f4u4
6>7Y7q7
858W8[8
<(<7<u<
0"010>0e0q0z0
0?1I1b1q1
6)6B6]6
7F7J7R728<8R8{8
8,9Z9^9f9;:l:p:x:
;B;F;N;N<
>O>g>v>
<0Y0}1
0+1F2O2
5"5`5d5l5
:,;H<c<g<k<o<s<w<{<
>(>1>b>
1k10292
=,=2=>=
>*>D>a>
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3p3
4 4$4(484H4L4+6^6
7.747T7\7`7d7h7l7p7t7x7|7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
<4<M<e<|<
=+=>=c=g=k=o=s=w={=
5?6n6_8
8`9*:.:2:6:::>:
636X6x6
7(7074787<7@7D7H7L7P7`7p7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9&9*9.9K9O9S9p9
:=:d:t:
;0;C;G;T;X;\;v;
1'171P1k1
6"6&6*6
<==N=X=
!040D0
q0#1*1g1
3[3b3_7
8#808B8J8U8Z8e8j8t8
9 9B9p9
:=;A;E;I;M;Q;U;Y;`;
< <$<(<,<0<4<8<<<@<\<w<{<
=(=9===L=T=r=z=
> >0><>@>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
? ?$?(?,?0?4?8?<?@?D?H?L?P?T?X?\?`?d?h?l?p?t?x?|?
0 0$0(0,000H0a0e0t0
1 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|1
2*222U2]2|2
343<3Y3a3
4!494A4E4[4c4
555X5d5z5
6;6C6d6l6
7!777C7Y7~7
7%8I8k8
9F:P:Z:`:j:p:x:3;J;T;k;
=2=v=}=
7!7%7)7-7175797=7C7Q7
8'8_8r8
9,9i9|9
:#:1:?:
;&<*<.<2<6<:<><B<h<
7%8,8l8s8
949;93:M:~:
858U8r8
7)7;7N7V7a7f7
;8;^;l;
<0<I<x<
>:>R>[>
?$???S?
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
575O5Y5^5c5w5
6B6T6l6|6
7/747K7X7]7s7x7
8%828?8n8~8
9%9*999>9P9\9o9
:(:.:>:Y:
:W;];b;
<"<=<o<
<E=K=P=k=
>&>8>>>C>I>
@0D0H00181<1`1d1
2X2`2h2p2x2
5(6,6064686<6@6
7$7,747<7D7L7T7\7d7l7t7|7
8$8,848<8D8L8T8\8d8l8t8|8
9(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;h;l;t;x;|;
< <$<(<,<0<p=
1 1$1(1,1014181<1@1D1H1L1P1T182<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3
5 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;
< <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>
? ?$?(?,?0?4?8?<?@?D?H?L?P?T?X?\?`?d?h?l?p?t?x?|?
2h2l2p2t2x2
3 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
5 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|5
6 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|6
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8
9 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9
: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:
3333333
3333333
3333/33
3333/33
3333333
3333333
3333333
3333333
333333333333333333
33333333?333333
333338
33333833
333838
3333339
3333333333333338
333333333333333333
334C33333338
33B$3333333
34""C33333833
3B""$33333
4"*""C3338
"C3338
:*"*"$3338
"*"$33
:33:"$
"C8338
"J"C3333
3333:"$
#33338
"J333333
33333:"$3333338
333333
$3333333
333333:"33333338
3333333
33333333
333333333333333333
33333333?333333
333338
33333833
333838
3333339
3333333333333338
333333333333333333
33DDDDD3333
33333333333
333333?
333333
333333
3333f3333333?
3336Dc3333338
333>fC333333
c333333
3333333333338
3333Dc3333333
3336fC3333338
333>fC333333
333>fd333333
fC33333
3333>fd333338
fC333?3
33fd3>fC333
fDFfC338
33>ffffc338
fff3333
3333333333338
4DF334DC33
333*C33
c33*C333
33338?383
F*F333383
"$c33333
"dc3333833
CjC338
CjC338
D*C33383
C33333833?33
3333333
3334JC33333338?333
C3333333
C3333333
3333fc33333338
333333333333?
33333?
333333
333333333333333333
333333333333333333
333333333333
334C33333338
33B$3333333
34""C33333833
3B""$33333
4"*""C3338
"C3338
:*3:"$3338
3333:"$3333338
"C333333
33333:"$3333338
333333
"C333333
333333:"C3333338
3333333
#3333333
3333333:3333333383
333333333333333333
333DDD33333?
2C4"""D338
2$B""""C38
2""333:"C8
2""#33:DC8
333338
333333333333333
333333DDD3
:DC33:""$8
:"C333
$334B"$3
"DDB""$3
3:"""""
333333
333333333333333333
333333333333333333
333333333333
334C33333338
33B$3333333
34""C33333833
3B""$33333
4"*""C3338
"C3338
:*3:"$3338
3333:"$3333338
"C333333
33333:"$3333338
333333
"C333333
333333:"C3333338
3333333
#3333333
3333333:3333333383
333333333333333333
3333333
3333333
33/3333
33/3333
3333333
3333333
3333333
3333333
33303*
33303w
33333333
iwkkilgulpxf
MXBUTTON
System
SysInit
KWindows
UTypes
CVariants
SysConst
$VarUtils
SysUtils
3Messages
^Classes
"RTLConsts
QTypInfo
sActiveX
+Graphics
Consts
XGrids
5Themes
nComCtrls
Printers
WWinSpool
CommCtrl
FlatSB
StdActns
Clipbrd
YStrUtils
*ShellAPI
&Controls
MultiMon
vMenus
Contnrs
ImgList
EActnList
dStdCtrls
Dialogs
ExtCtrls
3CommDlg
(ShlObj
RegStr
?WinInet
UrlMon
WinHelpViewer
RHelpIntfs
ComStrs
ExtActns
ExtDlgs
Buttons
8Registry
IniFiles
CUxTheme
SyncObjs
RichEdit
ToolWin
ListActns
5MaskUtils
wDBConsts
FComObj
qComConst
rSqlTimSt
_DateUtils
dFMTBcd
DBTables
bdeconst
aDBCommon
SMINTF
WMxconsts
MXDCUBE
NMXGRID
Mxarrays
AMXCOMMON
MXQPARSE
VMXQEDCOM
Mxstore
|MXPBAR
MXTABLES
TImage
svjs8233
Height
Picture.Data
Hrj~->
O=aExl
8!h({N_9#
+@md^M
.eU}7U
YT'S=c
	ZG:tmi@
Xs;>U0
1A!0hc
-~CR.*^f
l.vjr&
6k1zQS
%S4Z" 
 r.t@'
)hS}K0L[
*T+So4
K)a~}\
p(={Je
`2^v='
[K@gN%N
|=_VNP
D]<^/z
VcU~ILF
Q8^cD6
t^loNsI
z^aLhZ
)H9Q052
8BDs<i
O9W,^[
4.x%*Tl>
`y7~UA
mQ\eL^
BaK:z\
2M<`e(
A@8rm,!
O<-E3^
D1EIW&
:NO]m]
2L|rH:
(?Y?<|
H*cfAJ
Z	}abR
"_CTCNH
pc\\n{
AIu22=
;:9V3e
M>4vA&
2?xo|'
ub>wMpn0
	Jeo;`uWl
Fo^_%$
U<C|rw
m;)7=&
`6~6kt=
Kh[Yz.k
qR5x"O
:_N'Mu{
$nxCG9
K[.|8H.
1;;mR>
%ame<&
8JBabD
3jaz!`3
ydALv{
RYyfQk\
.2g32)=
8&)A5k,
?<F~\Jn
3^E|Ff4
[%DA(h
n|JI{G%
%oq3&gB
DW}	oaq3
FFP^Gr 
_zB$B#
cMJ16:
w'y<_	
$;#_%	
7Ln&dO
S52y`W
 EH^-D
41a<?O
zO\XGTF
L?BM;A
m3Bfy;
0PW9CP
1#B~LB
V'c	kCp
Q@&u_%Cf
[;rzmQ?
=92s/(
97wc#Oyq
N?BY~	
@\)1L)
B	/,>J*
'%lJ/\
A``TS(o
=D5}@0v)S6
,K|hQQ
mdQaf:V
Px5)<V
irXf}m
#Z[WF]
z:o#!C
&-J}N(w
&vWr{d
m@PF1`;
qu&D%0Vp
0QHGA]`0k
cLpZgE
yBNcOI
60\0pg
9We+8Y
4mH*ff
vk"HEin
wl%}E%a
X5!{#Y
'%925-y
#	'hcm
O&~u, 
{y9CE<
8vYalR
,C_m+^
0yu?=Yi
oFR}%!
U84EJH
0o<@Uxt
RW\hcZm
ioz>h=
Z^xVMM
Q\[Vdx`
H,T5][%
Yqpcz	
	Rts96
vpA+:Y
I) <a{
Me)2um
#a9u@Bp
6mv&rS
,|}!9xM
vd]?	z
,"jn'i
:'JW^@
-L[ux^
YIheQB
IxQA<<
Jr.r^kq
B'OhqtL
# Af|M=
{!`Qta9C
P;=q>Ng
a\Uj,T
qjZ-n.
B\']vL3
v]~66L!
k'<8\	
_%};Fw
%~`N w
$<+A:'
k,S)cd
T^$k#m7C
zlQwcO
qnl%p~
1IDW_N9
}MufgC
HR0uJg
X0MxHI
2+-IPI/
H@U(7fRM
5o6$:PC+is
:RN<T]
xqR&oC
:X.mB"
Te:q2$
zsQ32<4
JOVV3Hz
	y9,))
>GL/!/h
00R	)\
4->A63e
dO8,g.
asu_%,
=Wi.Wa,3~
|%pUhW6
WXS<qC
ZSspL51eN
DB.!&g:{	
KF*5QQ
9X#:z]
z#nUxj
(j:e:0
E~s/nl
(M$EMy
LPe@Nk
eXQP>'F`
LNg3tK
(DcidG{
k~}YXg
I:s{KJ
r)_$Mn
f+* Bq'I+
[Cj^m,B%-
|y6Dt!
3y#B~|F
8qbGiE
;xaSC]
	K;YGS
\G' :]
9#Zz]eN
ny.:\=
JHsP\s
LYn'bdc
S^cSxI
!wejs)c
Ex'Tc*?S
VP7Y^v*v
h>f_x=b
E.=ms>
PmX&{L
5>Vh,53
nJ1Sf?S.
Omq}&(^
;rpzpus
$fFKZ7
l;x9[m
xo%IeZP
|nl/k)
>n{)X	_
zIL@T?
I$p$3j
EDE(:]Q.
G125bT
#I/X/o
!j#:R^k
^DyoXr#
*v1Ck4
X2g"?;
h?2^T/
5b%xl{'
4wVTa$`
[^0	<jx
hYSu>'^-
td%v0h
; )Hc~
qc{C_TI
siB$&W
F!>/h!
#3	!Y]
v0$l3N
n>kDr\
bC^3S0Nxa
 hjD^Y7
zrL9o?}
!JNm@^=B->
b69WCqP
=5Zc;Q
 G6E%oU
Bj#{z"
sW	r,Gk
gHoN[K
!c\fk9
O|Uwd/
mdv+yv
~,>17XV
gO Q6t
,6hN R
9RL"+f
LM1da'
6<g`7l
	k$S'	
]!jZ~<
r>V0g3'
7og]?&
jxT8"0
W-PRIE
LK754G
:+>QI18
AspaB|
+ Iuiu
U+s\6>`y
o+td{Ne
b,/:X.
3xN[V-
8_h;B6
l} b6U
8g%H#g	d
!'tB<Za^,
'=>6([yt
j*'Umu
2`O#??
CFNFl.
H7)hU"}
.P{,$	
DdB|)Lly
OsI1:xN
FbN!/D
pPo0E$$
,{9g@6
&a_<%Z
SYVMub}
(P"bnj
m,W*tCc
(*{#	l
g	btbW(
8i:=TX
D;q14BAT
I[%?bA
}A^F9]
ndX6B~
ev(5	0
~56CVY,
GvF8t+
r,~hQ{
~T-(6D
jx0QJ}<
7mOL#/
X:aX0O
S()(lB
?MxUY5Y
B@}fH;
*PU^<y
Hl/#v}'
C_/BQ[
Har/1M
Z-3~@.
%Tv-vY
e'OIMn
`1WHOO
^(D^V/O_.
AP"|9,
J.$@o|
zmz#0.
l*{*qD
UpHY./J
@>*4(;	
HqLCOM
\BV	"K
6nzho)
?guCO#
,<RKuY
*}Wq0'
[tVd8S9
/WN8tf
5q>|<g
-+Sn!Bj
R[Jijj^G
6c+(ZI
,	< ~P
>?m,-Pg
~X+yw#
^mYYw[
[wgjvn
A >Cd!
3*Q{BHU6hL
8"].9#
ODJ-$c
Fcet	D
m_ {/L
lf\PT|
yP=(?O
1@ar]F
wn9q>X
-F8`$@
N0/Ns=E
joe$Q{
'o_?K@P
wZO9wX
,5(j-\
lkJvTX
CQI^Nu
5~&4<o=w
BH)6Hk
2m0%O=
-P^AqT
.(kD9:?
f'y, o
>BW'Z>
_c^]~+W
cYt~Kw
t7e.nF
O9QS>\
.`v;}"c0!
F*hO4)
_p{g6?
xW?9,^
8gi,L_
CSbuD)
q14(87
RD<G(d
W)Cy+LC
5j8;Qs0
PwgpRz
V,`Xi}
m2E:mS^
}C)v7H
op	!}6%
]>r0]^
"CaQ)b
@HY8I3g%
}]d*Cs
h|VjK<
	wAgN:
zc3*Sc
3<ZIAYg
T)q;%3L
dyai.@~\(
v)Q;A)=
17z!y<
Te|wQp
D0ru/}
qnJA_`
*:/a.4
a~G-f*
::u?,A
Xrpym0
r400`/
*%c <M_
P'x;[I
.~-Jd`i
RK[?D96
Ks^CXql
y1D	]/F
l_TgX2
<tO$/t
B	35m<
vd~A9l
eC~M {
>^_*Tf
2K>6Hc
">EgYr
qK*AsG
clA?@M
*urg_]\
5H]`H;
}BtBh	
c?<AZL
*A,n+XS
0Fs\f&$
67O(R]~
V9u7k'
#+.&?X
U+WTf`
OFr=8-
Qdv[EIm(;,X
a*qidl
o 	SS5/P
>;.B4	v
aDqH'4hs
|.784L
[iA"4Y
,tlH_+
BKN5EGN9
1v")~%
 H0[RwgU
ew[+00	
DB1pQbP/B
[1d|xC
bzF{td
i-,Yr{w
}{t>^0X
#bD2SC
yK2P0\O
Tlc;yB
WEsE)Aj0
4We&>d
aSH6RB