Sample details: f9ec7ea6cdb586744c93f268dc7a85c3 --

Hashes
MD5: f9ec7ea6cdb586744c93f268dc7a85c3
SHA1: 44b41dead6ec61bda625cd2db09b59d814012f9b
SHA256: a7ac4364e2b706a02f5c211e0b402e648cf26602190d43a8fb1278552a533c2b
SSDEEP: 12288:xg48v+xMmX7TtHYDdT02hlBGuJrITFIeocKb2BVvuS4uJ:xg48mxx7TtHY02hl4VIcuQJ
Details
File Type: PE32
Yara Hits
YRP/PackerUPX_CompresorGratuito_wwwupxsourceforgenet | YRP/UPX_wwwupxsourceforgenet_additional | YRP/yodas_Protector_v1033_dllocx_Ashkbiz_Danehkar_h | YRP/Netopsystems_FEAD_Optimizer_1 | YRP/UPX_290_LZMA | YRP/UPX_290_LZMA_Markus_Oberhumer_Laszlo_Molnar_John_Reiser | YRP/UPX_290_LZMA_additional | YRP/UPX_wwwupxsourceforgenet | YRP/Borland | YRP/UPXv20MarkusLaszloReiser | YRP/UPXV200V290MarkusOberhumerLaszloMolnarJohnReiser | YRP/UPX20030XMarkusOberhumerLaszloMolnarJohnReiser | YRP/UPX290LZMAMarkusOberhumerLaszloMolnarJohnReiser | YRP/upx_3 | YRP/IsPE32 | YRP/IsWindowsGUI | YRP/HasOverlay | YRP/domain | YRP/contentis_base64 | YRP/screenshot | YRP/win_registry | YRP/WarpStrings | YRP/Warp | YRP/UPX | YRP/suspicious_packer_section |
Sub Files
2defa3203c2e34830412f9fc25bc52e7
Source
http://www.alsalemexchange.trade/loader/Wnit.exe
Strings
		This program must be run under Win32
Boolean
Integer
ByWl'Word
TObject
Irface+
lhd`S7w
26<xPl
wXdX.=
PRCuvX
SHY=LgW
h(2Jj:
dP",[]
u0NHJ%NH
h+{Hb`e
 <t$P0
$xtZXtU0u
N"	w%9
~KxI[)
TWARE\Borland\Delp&\RTL
UMaskValu
JChr0v)
ZTUWVS
Z+]xm`u
-Rf;` 
\!9<k+
<\uPW1
l32.dll
GetLongPathNameA
6q*f26^s
SoftwareG
cales27
:[I]Cg
G2;A#,h
?  t.<
,(^Sjx
Mhh~ETh
_DefaultPHotLigh
ive>NoAcc
omboBoxEdit
Windows
TOwnND0wStaJ
<''#OL
HD@''''<840'''',($ ''''
''''|xtp''''lhd`''''\XTP
agel( MSWHEEL
%_ROLL
ORT_(_
}.SCK_LINES/
y!ut(u
\toYxh9
	Exception0y
'EHeap
EOutOfM"
EDivBy
b~Range0
Inverflow\
;0idOp
Varian
ecalx~
TThread
?07<Hv
s99R|+@
w}\/QR)
VZwHX%
B0r=<9w9i
u:P]\u
* (()@-3$-	u
*-&*$Q
0()(2)
8,fk<d
,*N]1P
;r.Gl}
Fp3$f#
^3Xk_LQ
_.U<HtH
0inJ!}
9j*!%[m`
kFreeSp
;} gl7c
!;G$t@
Cpy6h4
_MO>`Kn
cChJTy
AddSub/MulDivGf/
Idivod_nOr
XorCmp4FromSB
TCuNHjo
Ft?Htb
O}&$QH
t6[u&h
I6;=@$
^ApO=5	[j
5U02L#
 SmaB:
M~Doub
Currenc
?Unknow
Any2E/!
Ftk80E
Aj	Bu5-
TAli\gm
gnment
hfLeftJ
VVbdTo
Middle
0"o0"j
^5C.?G
sAdapp
N_gTRH
T6XU,V`
H><0^0%
l6|b`\p\
< iAXi
'yy|iA j
Tag6$0WIs"D0
}C9i'U
gGroup
'e6,rA
HiWOh3
)HG7%l
]=j	4|
t AUe"
tOjC4]
;JeyXy$
Z1<lr(
0\H0%A
_x@[AP
mPhxvh~fR
KU<O^G
5[72`T
g2Nr]r
rH{!}H
BHOhbH,
TPropFixup
,mAoBO9
+yrFoPLWW
Nc$7-r
%Crws)8C&
r!-<;W
CxS^d*E
iP_UY:@%
)fLj{?|h
	M@(c"
,m^T;a;/
>D~/$.~
Z<Q&}D
DKafe97Ib
LeftTop
u1'sC?,
z W^}E
Z*$ |@ 
@|BlS[
8t9:q p
FontPitch
 >Styl
fIns0P
.FDiag
woross&%
pB^u=X'
g'cl64
MaroonGG
PurpleGT
Silver
Yellow
uchsiaAqua
Lb-{Sky
_ppWXk
`I\/BtnFU
&HTl0"
?foBS0
ANSI_CHARSET
5wDEFAULT5
?SYMBOLc_MAC
HIFTJIS
GB2312
CNE"BIG5
C/BALT
RUSSIAN
ASTROPE
?%?Tj<
]nB*r,,G
C+/VX0
Ix3"F 
BQ1t6Tj
FlGO0V\
(s^tsB
q!"448PQRa`
5D	;5pW$
1^	nhl
_:2e@kB^
C[bpH;G
"!t		 
;N#@f\y
,1Al !
D"AX,B-)
j0|bPH
~ISPLAY
`hRx6W+CO
,~)Vh'
Enum>lay
USERzDLL
:	C\#,
Ia3Viewe
ULI	aN
89r04,
0ZK: t
Sm]m~/
8_Xr0|S
jF%7+}
HF.SB'
>6_how+
###(,0
RxT#|d
` xe@*
uxtheme
CloseoE
?Part$k
yO4NnSk
"Rzna"
  2001,
2 Mik-h
}Olbsfv
 !"#$%
\C<BCh
VLUQZ0]D
u"Visi
@.01H	
@B,yJ@
	MaxLengtRF
BAr yD
/|iB(['
a|)v=~V:4
h_Yi $
\[z!,+
N8P7W'
IZO]_O
S|B0d(
Ohh!']B7ii
]b]	$"m
F'O LX
w(F<^xia
?Ignore
mdlg_h
y19AIQ
7E(AL("%s",4),"
,3)" JK
JumpID
!#3277
Hhm`v(!
dyal.o
e={sJX
dmManu
DMTargeta
4,l* F
p)P`-t4
|bebelU
$GDocky
0xNxfy
QR?VH]E
OWSEWEn
'HSplit
4\FLm4
f+PTmY(M
-;?~&4
xWSUuJ6
%Zt7lI
Z:Pjtc
XLu7;Wx
	WGl38iK
w$;~|u
#ECIht
r\@v;{Du
 $F0$l
6ZNn@0
EK2S@a
RPk71(
PpZ9)H2
$GRZ	F`m
`$^8`2
gV6^K0P
sumYSa)
HpVW$d+!L
Up0~("
J0HtNR
V_WpJXa
"9(83H.
hSh0aC
$0:@@#M
BOM'iya
/YAx*t
;BR$-23
n50>	R
=V-<0S
@5djQh
PDt1!FW
k(i3M*
L;!,BBu%
eZ7`M4
iJx(C{t
it*<CM=y":.
Da3BmM
Th-~r~@
&j73t:
\^7Qdxe
Kx:%(j
	d_{_ax
jAo9G|bIe
9;wlt4
!_Y$T6X
xX*	@%
1S.Bp0
hEFH%@
YI,,)9
*C};tP
K1;0u[	
{(Q$;C
h/V)CX
KXE[Esp
NLSC0H
IMximma[
0!%;ReLt'
$'wAnZ"
*Dd'I<`VX0
;P8u+O
~tpnRL
itR9%<|{\N
$UYDK-
TkKFd;
@&8|Sh
0nTC8S
$|Pgq,	W 
F*dLR9;*R3
OFO2BHL
 WS}8<
T=Dbd^
pTq9&6
J0tiA	
-	D(4	D
Rebuil
TAdxnc
L(DW&.
}=[;>4S
DNTra{
D(vI^!
1234567890ABCDC
GHIJKLMNO
STUVWXYZ7
E@))HM'Fx
fj`H&`
XP1cR%6
]y5Cu%
	5`u w
z`ow}n74Y
^X`fXU
O3=U'G
HU]ZFU
$rd4z|
P?:S?_D
%kz*_:^8
dg5FLT
ju"IP]H
?./8eL
[Y;$b}
L,/HDH
nQI8` 
HIh;J4u
'(8(Y?-
S/G,*}{a
<YAENC4C4R
&uOS6T
`b	#8>$
BThumb
UkFHBz
Primary
Vn`a-6P>
Xj(D_H
Use#R$
	.i>Nd
pPixTsPf
KB.(DeL
$a`!KS
q!UG!O{
t,LiH}
!hb<:S)
00>4h0!%
>)PA[PS
Y*WBhoyt
`yA/VW
]"XoHP
^lHz;~
tC9Wva
Vbgiph
	+#I+[
A@Jf'0
&You09T
L~	7kcp3
ItH1H5W
+5-;( 
t;Cpu'w
u!nHhp@.
5%/cNe
?DLIENT
ffo*!o
;fI*E^
WV%m\C+o
c"?t%1
#S '}ttn <v!]
]2,0Bw
\,boYD
s\Nxnl
W	+uK[
|th(oB
JZZAL"}
@A*'.\
@)J['MAIN$|
NVseBA
k0.)tZ!~Q&
!VZ+-	-
6un`!I
`mj/lqNqz
cltest3*
't<j@jsDc
l0y:&E
3.Bc+[/
 BrRA7Fu
'PAxh@
O;^`u0
/.p`I+4
laSMXt
#5E]`<
blGlyph2
TNum=s
@xME%W
knh |?
1ca?pp
x2ax++
'w\Ede0
jExlE>!
s*xvB4u
d(%&Q0
\$C,-C
U2./0 
%not c
N_B+v2
pS.@v[
FirstG
rth>[i
d$d814<
1L36PkZ7
hSixl9
BioG$T
lR&D P 
v3.0 RC2
7A,'{c
f@	YH;A
Hoabcdefghijk
lmnopq
uvwxyz+/
@c[7e={o
R{P?$dx
)X@jP[
2PTT+XY
hWl(l\&
|+p4pt
\&x|X|yp!
5O<B(H
OSF,46
at 0>$
y4<DLT
o,n@,i
/Bahna
bGF6Jm
kyFovd
s*"czf
f:nlzG
W	?gCm
ursRazG
i2mo7Dq
s{ql7$
.+gl+ 
+[M/.0*k
v7iHL7
y[[-8h
Uu#S(J\
JL?s;*
ptN.T#
^_CGP\
 R$koR, Ax-
ICQ - 210091
w4W(Rr 2
(9504466
.bq.c8
Kzf_JlC
 (sec):=
 3 by1
eZV44.	
\Xz2*l	
|{q[[M
r/z[#U
lstrcpyA
Virtual0f
IcO2+Mul
adLibrar
AdMJhc]LVf|
FzlPat
ec%!pN
aD}ROP2
JDC_tv
tP*'{,
rOfl$)n!
3	4)%~
ook?sH
kcLong
tQuC!U
aEI@O&
|*CODE
N"@tls
XPTPSW
smpZ\]c
l "&p  $p
tmt+QIJ
qkupqis
piqKUPX
7'%(Z--1}348
tlsBPHI
ohp`TLO
tmvJpiq
pjr,mgl
$+)+G659k>=B
74;T~{
slqvNFG
ngn}NHF
qiragag
0.43@?Fflku
0.4Z|{
sksXWOP
xr{\vox
slt:ici
mgo{icjulfn
&@=BPMJPgWU[
<;Bc1.3B
2omyo{z
539`]\d
.,/JZY[
idqfwy
skupzw
lj|de_b
vmswZRU
zrxA\TW
wqx8\TW
vmu<ZRU
qiqhWOR
qjsKb[a
yqz%voy
rjqWe^d
wox_vov
rkrrb]c
tluoslt&
qks6ohp
)),.QNTYd_fskhp
NLVsJFNY&$).
\Ye3khs
sl{:qly
qluOso|
_[cOa]b
pjuOur
]Y`O`\_
mit?wu
ofssws}
e]jJsmu
a[_Rd\_
b\_<XQS
d]bOTMM
e_gPUOR
mgp:ZT\
vr~wnb^
x~_d\`
vnu_]UZ
umup^V[
tmu!iai
tmu#pjq
wpyyvow
rltymgm
tmvbslt
rltbpiq
ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffh
fffffffffffh
ffffffffff
fffffff
fffffff
fffffff
fffffff
ffffff
ffffff
ffffff
ffffff
ffffff
ffffff
ffffff
ffffff
ffffff
ffffff
ffffff
fffffffh
fffffffffffffh
fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff
vffoff
ffffoff
ffffoff
foffoff
foffoff
%1;DDDDD
$1;BDDDDDDDDDD
+DDDDDDDDDDDDDDDDD
1DDDDDDDDDDDDDDDDD
8DDDDDDD8
1DDDDDDDDDDDDDDDDD
$,,,,,1D8
1DDDDDDDDDDDDDDDDD
1DDDDDDDDDDDDDDDDD
.666668D8
1DDDDDDDDDDDDDDDDD
4======D8
1DDDDDD@BDDDDDDDDD
1DDDDD6
DDDDDDDDD
$$$$$+D8
1DDDDD6
DDDDDDDDD
8DDDDDDD8
1DDDDD5
DDDDDDDDD
1DDDDD6
*BDDDDDD
1DDDDD5
DDDDDD
6DDDDDDD8
1DDDDD6
*DDDDD
1DDDDD5
1DDDDD6
1DDDDD5
&DDDDD
1DDDDD6
BDDDDD
1DDDDDB6626DDDDDDD
&1....2D8
1DDDDDDDDDDDDDDDDD
8DDDDDDD8
1DDDDDDDDDDDDDDDDD
1DDDDDDDDDDDDDDDDD
1DDDDDDDDDDDDDDDDD
4DDDD1
1DDDDDDDDDDDDDDDDD
(DDDDDD1
1DDDDDDDDDDDDDDDDD
1122222
".8DDDDDDDDDDDDD
$1;DDDDDDD
CIDATx
gk~617+
KH}8XK]
._[(_g
>	}^	u
KERNEL32.DLL
advapi32.dll
comctl32.dll
gdi32.dll
oleaut32.dll
shell32.dll
shfolder.dll
user32.dll
version.dll
LoadLibraryA
GetProcAddress
VirtualProtect
ExitProcess
RegCloseKey
ImageList_Add
SaveDC
VariantCopy
Shell_NotifyIconA
SHGetFolderPathA
VerQueryValueA
&$%@*754764341&$%@*xlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmzhzngizjxjyfvlnhivkmfiznyh{zgen{ivwfevjiee{leey{zvz{zyeivjxhxnimfgfmjennkivhxy{lgmhxexezmyzjzlezfxfmgxnnn{m{nnexjmjeexfmeemfwjynjkhekk{xyh{yhizzw{{ngvmhmyxjxhkifehxevmjzjyyyykmiigxev{ggxfiiizzhzw{gxvwxnfvhiwnjzkifzynjehvx{mwyn{lgkvymh{nnwznjigknlmlhgnwhivnvh{hgige{keihgzfvf{{gefk{jzwwfxhixjxegkikivlgkjmfmmwnh{ezfkmivyhexx{y{mwkmylxfnjhkgzgikgfvvyzjyfylgefeegvjjixhix{ijix{vfivkikkzzhvwwnjevjx{hfeyfxyjvjknf{k{yxf{yzvyl{fmyfkigiimfv{v{kg{ezyynwlwjmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhylexvwjvz{{x{vmh{kz{{fgmm{zjm{ek{ngznfnfzxyykm{zjghizwikkkyykgnnjigmv{mjvh{ynwjxiknhvf{imh{mznfkzf{jfmyfvnfzylxnvhv{wl{gxfnyvhnhv{gkfz{evlivggv{kgvfgiv{jmgijzjehvwwm{ezgxjezzkmzvvf{ijzwjjivykehehxnlezvwvjzfvwgxxnzjggxwwwmljz{whzhzyhixn{{{zljgxwxwzxhkimzfzw{ehe{hhvgxzvixeefm{xv{whnygknh{fzzzznfjkkkiim{emvwfkzxmhig{vnnvyfxnw{wylxyjihmvhz{w{eijkmfhgkizw{lwhemez{ehijikkikmhwhyyizw{hzmwiegmnlz{ieeevjfvxlvyvnxjzxwjhzkikkfihv{jfkkmjg{v{ngvmhmyxjxhkivwjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywmfiejgmwhxex{evnggxlmhvyhvfiw{izmjhvhvfmjvxfjz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekmfixjgewnwfvjgxfeyjnwyfgvkemjgvemv{nnixznfm{v{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{jfg{ifewwxhhkxyjmeghgevfkjzeifmzwezjxjigvgvzlfeyfx{z{zzjkmfylekgiv{iiv{{v{hfihk{vxf{{vnjivffihkmfwlxhvl{hnwfkkm{fz{wn{zv{fzn{whgxhgkg{lwhevn{jvxjgvjxizxnemiz{h{mxjhm{ivnnyekn{{zmj{hz{mhgmfgnfnww{vyjvxhz{kmxwzzynmnzywnyl{lvjie{l{lfihizjy{zngznjnhzymlwhimnnwhhixj{y{{hgjiek{jm{zwimgiggx{z{xnnfjejmfzemnyjgvyimxfgiwwek{f{lezfvmwkefemwwlyfnlekwhivw{giwhkkhi{nhe{gfk{hgz{kixgkhim{nn{gxlixnh{heifmigkifexhgvkgx{nnmf{nexwlkevjhveefmgeyykmgxex{yxhyjhxkkzfekgmfkfxnh{lzfwyivzh{vighmxjxhynwymh{gyhwn{l{xkgy{kghgjzjigihiii{xemvwzfkkyfzl{ym{{fvlzwevikzjmhxl{jz{vf{lywgmjxxhn{xnvjemvym{{eeeggekeeizmlik{nz{v{jkzzhxxwzyw{fzwynn{hex{ezzzxxhfzvhfvzljzfmm{hgnhy{jxkimhylmngkjxhg{zxn{fnyzwgi{mxf{hzjhifmynzzynvjkkwwyy{vnjvnzfjk{wexgizxmjxhzwimzvwnxyfkfzkmkezffm{wjievfxvnegjx{nhmnj{xikvj{{gvjxgzgxjkjkwhzhkmkifxjgexkkhewlkifzhzji{kxngmwfigwj{jjegey{mhivimzlzneewwwj{eiifkwjhvkmhxxhxjmjjvhgggznemzjezjxeiwwxyevigm{nynnhmfxzvmlxhn{gmegjevwylkkyhywjkvffewh{vfvhvvjjmgifmxyem{zikkefijivnivxyz{zvzffk{kgvgzeehvzwmfjgw{nh{mhehenljknnjzxnhkig{njezl{nvnz{myhivf{{vfyyzjgzjxgvmlxlfmgmkgkihxkiynyjjgzwnynjx{nfn{kewnmjjzxfjveimhwyjxhzwhimjgwnyjxfign{njyfnhfxeggx{ywygggvkeyjnyikkikeeegkiieigvxlfz{{fkvwizmlge{mn{zl{mhmfmnfhzmnjvvyezighzgm{njgfzvy{ywl{ikkwfhkmjhkjeiefxnly{fgjzhmkgjvfiznfkmhxfnlmj{hvjjgzwynmyjkkiim{nx{yjivywkg{{eznwmfzyixxjik{w{jw{v{jmwy{wynjg{iexyyjx{gnhzhixfkvnxnwlmw{wfzwlekwyhkn{vwmhegywnwkmz{iv{f{wnwyfywxlgz{nggnhmwwfhe{mizgkvjvhyjvwmlkiyfex{znnzjhz{kwhzjvhkkvfnjei{fmhw{nwyyvjzy{g{xkmfk{fw{vlemjivj{m{lnjzhn{nhwwkihk{xvwxhjinjhximeg{nm{izgezjikjvmn{y{zwn{yyneknwxnvnvnkivj{iji{g{k{i{ljezzxhmhzvnjzzxnkivfwyiegzvyxhkmxhwhxnekw{xh{wmygv{jwhgm{{mffmvnfmjxz{zjz{xwm{jxzzeznjfimnzfvnji{nvfz{yjki{w{yjenlgmz{izegggixmjemfxjifgjxvhkieifzkmz{vhivfkexgennfzwnfkfm{nvjeigijgyfmlynm{{f{kfikiem{kmj{jmy{yzlzn{l{yig{wvnemvjgiylfzeezfzliz{jyhzwhevykm{hwhjikmeviivjizfijmjefvgxmw{jkm{vkifxz{xwwwyl{xxwvnemmnm{mjvfzyy{evjky{ylzwy{keyw{wxjzjzjywjkfmwhhxhxhkiixwfimlyhnykezwemnhmwhvgxvlxyig{kjmkkm{nlhehvhvjkeggkyyfvvhhzvjkgyyignljvnjevyjggex{evn{{fmvjzfn{{jyjn{{fwygv{xvniiiz{fyyfeevwngm{h{nexfmzyvw{nmhwjxjmwki{ln{ylxlfmmjvlikyl{zvlynkkxhmyzy{nv{vymyzny{zx{fzhnyzlgvvlvyzhxywjw{nfkmzhwnxweivlke{{iijmfgekhmzlnwxyfgxf{i{xfzmh{xgiylkk{w{mzlv{ji{limmwfkfg{nnwgzgezfkejznhwyyyzljihvzvjm{ynwjenyhvylmfv{vhegm{vjegnhezvwfmvy{iylzhjxjevyzvhvx{gxvjwjvw{nkgyn{gn{gmhkvlwj{ygvyj{hyy{i{gigmf{g{e{xjinl{g{inhgvhiywzvjmyj{iezzz{m{iyn{hxjggekzy{zzhxfkezfimjziefzxf{hjv{zixeggkzyzjvheefmwyeiezkeynfvekmh{nfkv{fkyhekfzvwgevlevvhgmmyvww{zymjyjjxvjhgxfmwnwmwnjivhvxnnf{g{{zjnj{wkgfgjm{xn{wjixfmwlevixxhexvw{j{mjzgiixzjfkvjhefmekvyfg{jmjzw{fzhiznnwyjewhvn{v{xy{njvyvyzn{ymhzwzlfegx{kfeyfjmixzzgimnvl{lx{xhfvegn{geei{yy{yfkemlwwfk{fzwgzev{ifeexgmwlhgwwm{xj{fkihzwwie{eyjzyieznjghgzhyy{{njwj{veinfikikwywwyfvly{z{{evnwnheimemvj{mxjywmf{ifvfiyfv{ieznxyxhwyjky{ekkkjm{limmfzvgg{jfeynvnhkzhyjvjeg{gxjzzynzhkg{jvniiikgmhkikjmjxzzfi{fyl{{nl{{he{kxhhxxlmlvfwlgzkijefevfeggikkjxwjwhwfgmfz{wwym{jexhwfx{ivnjvhzvimwfvwvlkmynxfyfnhv{wwnhzjzv{zfefmzy{gxhexjkhxxhxnivekhefenhkkmnzwjzjgvnzweiynjkzymwhvig{izwgmvnzzfekm{xgigzw{jxjghgvyikwnkgjifmzvhz{fhx{hixzwvwyjgehkvffxgigizvjznfnw{wmjje{n{hizeixn{ygmemjejkxy{kznjgjg{{xnjmikkmxjhvexy{gkzjyy{xggegwjiehk{wznjkxlnhfzzfhk{eevm{mnzxzlmj{g{vhmzvx{{egxhenfyymnz{{xiexy{zn{iggvgeyyfikgy{whimfkhixl{{xlfghgfehxzzfkjgvlznyffmjehvhmyjfmgm{w{n{imnw{fzjiiivfivvjjvjzfmvhwjzyfznhmjhkgzzjekmn{ivjzxzwvjfix{y{vfwwxfkeyjekeifvwfjm{vmheghivlegjk{khx{ykgnnfm{lvfnn{kgmzlkezvwwizyffz{zexjm{nyyhzeez{{ffxgivnevvyzyzvfvxw{ejijz{ivykg{jjvfgzfzxyj{yxhwnnfnf{zjghxhgx{{ijvjmywwnvlnlieevjgmlml{wiiyyhkgmekwyzhnjxyhxzfwhwf{gyjm{hxnngmivhx{njk{hwnzzwnywvffv{fikixnwmjjizhhxz{fenwhgwnizmnzjhmfmnwie{ggxyl{h{gixfmzwmhzxzhzxzy{{fgnwwniz{{{n{kwymlikmlnnzwxnzvxnegy{znfvyymhnhvfzzgkfmzhgxjzjvieeinfwlvyzhmjfxzlhkgifkwhzwzxzygigiwjyn{mmfkezhzw{fkenlmy{kje{xikwlyjjmmhnf{hjzez{kgmnl{nfkzlhgjkmlwn{yxjhzxyikevmwevkgx{nnznjxwnhkfvmfzvvwjxhziikimygmfk{y{jigfvnwkkjvwnzlyfxyvfixvlmnznvnegynmyx{mfjxwn{znjki{zxhfx{{wlmwjvnjnlvfwjvjeijgmjiihzkevyeiekexxnnhynfi{lvhfgekimm{vhwjnhxffgfx{ievfx{ezfzwzwxyxwfm{mjz{jjvmhnjegyjhmgevyyjizhmjg{myywfnnegjiyyigzfy{ylzhnw{lxhmnnw{nfgfgvnwhnyxlhejvxlzzjxiigk{lexwfnj{wevnj{hw{nhjm{mv{wykg{yekikikfzzwy{{ifehzfkegv{ezxwkgjzmjfx{{nn{n{jmjn{jejgv{vjgeixyneeylvfkkx{izmhzzwwjz{wwjnlgxvffvzy{lkeiiik{z{wwjkmfexnvwem{nikfejmyyjkkg{zjmfxiijggxgmyhkghxfegmnnznhvvfmyzx{mhz{hgv{xnwvy{w{wmlixfmy{gmfveinyynyhnhegm{{lz{zwhkywyjfm{hhz{hn{{nzz{{x{{nhggiix{gx{ixvhnyz{njnjjkyjxwylggxl{fyfzzxjgmigfizfhkhvvfnhhi{f{g{whgxfvhmyhzfi{ijvkkmjkmik{kfknfyywfnnywfkxnimmwvlhv{n{gfv{zxnjk{nfzfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxvf{fyliggmzvnjeegikmgzfmyjvhvl{gfk{nhv{{nnyfjm{xixggmfzl{jfmgzezjx{nzyiigvxfkg{wkifikejv{wivnfkinyvfmyfzeeigjgemvwkeggzj{zzlgkhmeiixvjwwwhvy{vm{whgkjin{iknymwfeje{nzxzvzzixgz{fvnznxnwyjxkmmyw{jgyn{ikgzxkgzhvfkinnhvmjywjzxwm{{kjkfi{lvjzxvwkizz{jhe{mjxgkimnnylhimnixfzfvvfyjmnimxlnnyfwwzh{xgiylywwyyffmzyfvynwy{v{lhieekggzjziey{hgzxfk{mzfzxfv{mn{kexl{g{gmyem{khxgzgzmfmhzlzlvjegfxixigjvek{{{v{y{xeievfifmikeixyeijvwynjeifiimwynwixhmwnzyxnhgxwzjggfzmjyfgefveggifikiz{fmzy{jgz{mjvmwmwjev{mjievhexnhevnljg{{vfmfhvyy{ijx{vkewfywkkjvnlnjwj{eikgvhxevyhvfvnmyvfmjyfgmmhxyxjjxnhxleehximhzmfvlgzjinyzlekmygkkmwhjkvh{gyfik{higzw{zwnezyfkiz{mnjvvnkmgmnnvfz{{e{fyffky{xyiiyhevzxzhivigfxii{zjigvwjwnjkn{yywyezzwwwzv{iz{gzimhgmlxl{himyyii{ivjfvfghgmyhxvwhiienfxlyhxywwekzxkevynlvjm{zneenl{n{giefzjxynvyeejzikzjx{xhynjzhkzhv{igznekwjxj{iywkifvyfyjyjeznykmhkwnzv{hhvnffxmnix{{mw{hy{fiywvlgm{ymn{yggkm{figz{hgezjkzzevvwyffkei{xyyiimwhkmhn{{fgmn{zfzfjgkg{wmfkmzhnwge{wiv{ewfnnx{mymyhzfkyhhkjzyynn{in{zvkggxivie{{ix{nywzhiiznxlvyvhgxwlezzf{wfezfivvhxfkmgkvwhvxhgzvf{hzjn{my{zzyjgjkfg{x{ljevw{mnj{ngiw{jkjvfimjkmgehzjenjzyhemnxfylmwkmwyzwnnzy{nkmylyhylhihvimzywwzyivjgzyikkiegylzljgzlxwzzzhnhvfkgnhjmzviijivyjeyhexjgjg{zjznhzyxhnlzj{jfk{hznzxmfxlhexjnhzhv{ex{wwhfzjixhjegzjmhinnwn{lizfzkmvykiex{ejxywyfhizhfxizzny{y{gm{lzfkmzngz{{jzeg{w{gyleghvvnnnyfgv{hyyfvkkkezzxnxjznzlv{mwkmzjxfxfhxxjgmnjfxnjekmlikvhzjnhwl{kjigghxjxx{xhwynwzzmjzwy{fiiijmvjjihzyfexjxkkzxggjgzwvhyjexvhkmgvgz{jivjkjezwizgxem{zvnvwmjkmgm{mzykeev{z{exyhzwn{z{jv{x{jvvh{iv{zxyhfxzywygxmfekzjnwz{wyzjxnixgikkxhvwhgyjhxnyjkexmygkzhx{y{mj{mhvzyjinfylfgxnxheegmhzhzzv{mxhmnzzhzjxxfxymw{vwnjvhvfxnhnhwnhiimgx{{ie{nyyezgvggjmzywnnyhvhg{xynx{zhzv{eikfem{nwvyzfvjjvgknlyfnfeejzwjzwyngmmlvjeegijg{wfzyjezyw{g{neghvfmnnyfml{xxjjxxhyjznjvnl{gikjimwkkgvkknn{wmlgifi{x{kvhznivgekg{j{hjikmjg{yjihxxhkgivwwfkyfzvmhxyz{xywfzvkifxfxxhxyxhjgwfwwgxekgim{kmivmjegfifezwgkzlevzhmhggxygvwljzevei{e{wmnxyylwnfifeeeywjxmfm{xhevhveix{giggxnji{yegmhiz{hxyzlhmwhylw{xy{ljgyhhggg{vzzgzjxgkzwwn{hiehxzlfiww{eznwhfeznylywgzhxnlfgnwmneewhzhivnhyhnymnhezx{zzwznyykizwkkmn{mxnhzxhvfny{gkgjmjxjejmkewyekimgiyfkm{livwnwyivgixjfzggww{v{nxhmfnl{kfgivn{kkvhyj{mhewjhiegkkiznnwfjmv{{{nhylfmznjxgmwfjxxhvfexgviikgxjmynhfk{kwhkkkkywznm{hkzjjiggxjgxhkhx{nzzivzzmjjmylmhkeezjxeigkkivwxjheiixhhk{vwwzlekmfgkkmwyjkvjgkyfxlvyigmf{zwngmgimjjzxwmlm{{efkkmxyegwnmwyffijmywxhywxhvfxnezhxnhzzzxjigkwjgm{f{h{mez{fnjylzxnn{lgxeehgzj{ngiyyjxxlekwnxyxhhxekxwv{zxievwxliejmgixlnynlkgjkfzmyhxx{njnhnnkkwlgv{jww{hznhgmfhzvhkmvfzhhzwngzvffzyfnhx{ynmwhimhhv{lvhxhkmfxxjzxz{xneefefz{{ii{vgxfzzvgm{k{wxfevgzgxjvz{{n{hylvlxjnhgmyfyfmwixv{mlx{hvivgmvjzlkgixxhkkxfkggzkifmkg{kwwzwkkki{gwfhv{xylexxjyhyjjkggzzekzzgi{jgmwyjgxjxyfemhkihmkkyywww{mn{vnhgxeky{njxljxjk{knfjkkeiiimznvwwwzxzvjinjyy{wfvevmfkmevz{zzwyyfjk{lywyhjxjgkmxn{n{hvyzvzh{zzn{ijexn{hzwxjzfzwyliijzhgxyw{{fje{n{ygzxwzzekegizxh{yzlkezyzhyfznxl{yjmmj{wjijmjvjkmnjghxzhjzzwgzxhvlzjhmz{{himhimfxjhexhzwzhkiji{wmhfzji{ljeywm{{jmlwnxnmjfzkmhkkiyf{e{j{eyfek{jiiwjylfznhgmwheexfgggzkkfvegki{gjgjkhvfgjmyfnj{hyykikkjxhkxnnj{gzlvnmw{ykkxfy{{wxjkinjwjvfekywxnwlfk{jvwjixhw{{yyjkgxhgm{nzzkgkggmgkxykmigm{eimyhmjekkmjfejgvnhk{yjggifmmnywnl{nfmjezwzfgxemjmmhzx{v{{fizneijxv{mfgxxyz{hv{zjgee{ljzgmxyien{jvei{hgiggzhm{gveijzkeyjjxkkvh{ivyw{jzywjgw{whmlyjvygzhmgkekhvxy{{whzlwlzzyyzv{gki{gjmig{wyfgenfywevjghxzhxygizygxjgzjyy{zx{yfzhwwekhehx{mikxnxhkgkkfzxjjmikmhjmgeikwnhvmj{ikmhk{{wn{ehxgiz{njzxzhzljgvngmmjvfee{ngegzieyjexhe{gjxz{z{fmnnjmie{xemizxhvlznjxnh{gxjjifzwwgvkkkg{whznhnjki{kvhzniv{jkghimjjikmig{y{w{wkkgmivgmezyfn{fijxwnxygeyykifvfxkkwwxhyhwjwwggekmj{gkmywxjegzykghzkgzlemfgmhgmgi{{wwjzvhfe{egekmxykiwnfgjveehzgimf{gxhezfkeihiizggnljikmgxmhjxiijxvnhm{iylw{iieejgzzhgww{mzz{{ywgkgiwnxygghxnwgkwwhgznfx{{znhkyw{wienlfm{fmnyhhxzhm{nhhzyymngx{z{zylzny{mfzwkkn{{miihzkkzjnymyfejmx{jeyhhiwyxjeemjhmkm{lgmwnkkxnmjxyfzgk{l{vjkyjgmee{kvnfkn{{wvhyjmyhegegmegjkizfejkjmvnmhnhynx{zngmgmwjkmxhv{xh{{jmkggznwnhv{vj{kekkkivvfm{hiwwjiixxjgvkghxkizzivvymjjkyhmh{fxjxyfegkxjzwxjhe{xxh{y{vzzylekn{jzxfizjkexzzyf{vvyzlix{zmhzlgi{{gkxw{mm{gg{zkmkeeg{egkyffkeiywxjnhkkizxnvl{gnhnj{zjifkwjmhiz{hhzxj{fzfylw{yy{ljghghg{v{ngiyyjx{v{y{ezjxhjggxxwex{zzn{hxliemhgigxnyfgmjjkfvxnhxyyjznhmfkkfxzj{jfvxngvkm{y{ijiiv{mgvjgvhgzvlvnyfxw{yxh{mzwnwvjjgfkmyhxjgxjwn{ehkmffemwnyiifi{hvnmjnynnkexfvjyygxzweghekkylegwfnhgifeyfv{ixfigzx{hvxngmvnzlxh{xxh{yevxlmfkinhjm{kfx{ykk{w{gfxxn{xyjfzkixlyjjgiezzhizzgiwygmwnjgxjgekggkgvhmxjyyww{{xf{vfkgxexvhnjgvfkjkixnfjmekiiy{zn{zekzxmlxhnjjzzym{{wmfgxjgz{zxzhyfwy{lywnwjxkkjgxnvl{hnhxhzhhxgv{ikgxnhknlxj{f{yylmhjzxnxfw{jkfm{nfegzjxnjekmlizxhgezl{lnfzhimznkgmwjmmhxhjinlggjkgmjghx{mjzggeikkivzjhimn{hgvzhgm{ehegzvwzhv{fzgzjvfzjkmljeyym{{jmjwnxwevfzmjvyxjee{exnnhyf{i{jiijkylfzyhgmvheexfgkgzkgfvegwy{gylivhvnhgkyfgz{hyyjgkkjvhgxnekvfigv{mw{yigfkkgigz{v{jmjkwwjigzmfwlji{j{xji{{{{hzyj{ykk{hxfvlwyjxfiekzwvnkivwhexh{fyyxhx{{{mhwynnjmwfgiv{nhyw{vz{nfjizwjey{emfxjzzxyn{{njyfeige{emfmjxyz{hm{zyfee{lvhgmhgjen{jk{w{h{xggikxwgvekfikemwjx{wvw{ikeimxwnwjg{ejvmlgx{hgzhggkekmjxykmhxigfvzzikhg{gkggvjmnn{whz{infyjevjg{jzhxngmzyxfjgzjzy{zxy{kzhvygxhe{i{mzhjgxhjgjifzx{jmyw{{jmzw{zwn{lmjfzkmhkxjwn{e{jgizyvyzxiz{vyl{ggmgmnneezwgegzikyjfezl{gfkz{z{zjnnyfxl{xignhkkkeznxnn{{ghvexfzevgv{wyy{wzznhfiiv{kekgvivfefe{j{kjikkig{yjm{wxh{{ivwwezyf{zmhxyfexyfxyjkiizjkkkxjxhyjwjwwznekmjmykmzf{fegfmyfzwiizlexfkmh{nyw{{ggjzvjje{evhkmjxjvwnvwjvee{ljxgmjxxhn{iveixnnhml{gxwjgyf{jjxzniiwffvfg{{yyjzhmjgnfjkv{mlzj{{xwzzmlemjiylhkhkxwwwkkznfxhxzngzgigzm{nlvwxjmnx{whzhhmnhzynnmnhx{z{zy{znikwnzwhemnwfmwhz{nynny{gkgjmjejeyhhiwynweemjnlkmjvfgwn{wivmjzwfzwywh{vylfzgmik{kvwevn{wnzwyjivhe{ggeegjiiznnxnjmvwx{nhmlfmznyjgmwlgxxhgeji{{ywkghen{nhgg{w{kivkky{zjm{imwwjiwyxj{yexhxjgzjivzymjjmnwmhkifxxyvfgkxjywxjxl{xxhmy{vzxz{ekmlnjkmwwjkvjggyfgx{hzlwn{zmhvhgixhjzjzwlm{wwevkmjg{mwnzhyffkjmywxhywxhwyxnezx{nhnjzxjiwywjggjg{hmnezhmnlylzvyf{lyjee{lny{ngigzjxnlekwngexhjk{mxwv{{zznfvxlylmwgihkxhfg{vjkwl{yhxiiyynhgzkkfxzz{jgi{hznnnmfiewykmvlhihzvngzvhfzyfiejeyngzhizveg{lkmxhxfhvxj{egixngiyffzixiifkhifzzzy{{kkkxfevgzgx{{wfheeeylfe{ynhfmkgjm{xixvnynx{{xxngmfkzlkmjexh{wxfxlyfkifm{k{kfewjkk{e{gm{xy{xyfjixjzvyjznexzzhkvymjhggmwyigxjzfkggkxyhm{wnnwwkgmn{vmlgxekginjgvfkjkwjnfjmzxiihi{{vwkgzxmhhxnjimzym{izmfxhjkz{ei{jyfvw{lizn{jxjmjgkez{{hv{vfzhiegvwjwwxnxyy{xjzjvhylw{jzhg{jw{zlje{nzfgzjxynekegxyxhvjzljvzzzhxy{gkgyhjm{exhjinlggyhjxjgjkhejzw{{kkk{yzjhgfk{hxy{zmfhzhegv{jzh{{xhgzzjfzyfnnjehixl{jmfwnhmezfzhzwwxjmf{exnvlyfnhzhiifiylfzvhgm{kzfxfwwgzgxyjegkg{{ylgihvnhjmyfhz{xixnhkkx{{xxneiznigv{mwkigvxfgzhxki{jnjfvzfekzznl{gz{{jv{hxxhixhzyj{fxhzzigzzmjkggmggxykgevm{{vmy{fjgkkwwggjggmiigxgmgifgnlywywegnfjxzwivzxemgemhwyez{{vwyfei{h{emfgxxyhveg{z{n{lhgimgmx{{{n{izzy{hzyggzhxlgvn{jzxneijxkgz{{iznw{jznyjgw{zfmlxjvygznjgkexevxyxhvjzlgezzikgz{gjiemjmnj{wjizxnfgvevjghmzhxw{mzyxjmnzjmy{zhkznzhwnekhenw{myyxfxh{njifzwljmikx{jmzw{z{eeemjmwy{hkkkig{ekegiz{x{zxje{vjg{xgmmlvneezjn{{wkgyjfehe{gfmwfhv{fnnjknn{xxjjxkkiiznjzvh{gzlxhmwy{gvkkyj{wgxgifiz{{kvfgvivvjfe{jjxjikmjk{yjm{wxhw{ivzzekyfzvmhxyxjxyfvnykijiezxhxyxhyfzwwwggekgifxkmyw{jegwyfvhzvyzlvh{ymhvnnh{{fmjzfejm{ekimnjxzxwnvnjzeeyjywgmy{xhezgmeihmnhggynjikmfgmhke{xjxzfhmwlgmw{y{zvjgyyhgww{nzzggjxgkekwn{hfzhxyygkwwn{zn{gexznjmgi{w{ynlfkxnmnhvhxikzxnhyfzjmnxnik{zyyznik{zzwjmn{{mxfhzkmgznymykgjmxjjeyhyhwyee{lmj{vkm{jfgwnvlivmjhkfzzxvy{vznxhgmgx{kfiezn{gzvhyjvlhewjgmegznnhnnjmjmv{xlnhxlggznvhgmwjhixhmwjigvfgkggzgxnhv{{kwhekkkik{gm{mnzjyjvfxjhegkhxw{zjivjemjjmxnmhjiezjxzlgkhev{xjynhkxhjz{v{ez{ekmyjzxfjvjkvljeyfzwiiigmw{zmhzxgixjnjjzeim{wnezkm{hz{wnfvyfvnemywgvmjxhjexnei{hnh{ezxjigkwjgmgm{hikezhmgeylzxyy{lgxeehgww{nw{kgjxgxzw{ev{xhznhixwkmzhiekmxliejmgiynjinljijkfzxyhxnnmhfkmjkkmngz{jv{{xzn{ymfhxv{kmjvhizwiggzexyyyfjmx{jezxhimh{v{l{wnykmvwxjmlnhxnzvkgfzfkiifigmfzeegm{kjkxfn{vjgxkkz{he{jyleg{ynhvhfvjmjmixnhyfx{xjxngmn{zlkmixxhzwjgkggvkinh{k{kwjekkkzz{gm{{j{xiejixjnwyjjkiezzhmzjgizygmgiizxjjkfegkiehmkggzwwxhjg{vnjgxeknlnjywjxjkm{nfyfzxiigvemvwkgzxmlienjxh{wm{zhmfxjgez{{m{jjmke{ljexjjxzljgxnvy{hnhxhzhhzznwjn{xnhkz{xj{h{iylxhjzhkxnw{whjehe{{gzjxzvekwngixhzjzlxw{hzhyh{{xlxyjmzz{kjifxjvjknfjgzyhejzfigzkkeezjhgzh{hhzzhmf{{hegzvhzhhzxh{wvffzjkiejeiknn{jyjwnhkizfzzvzjxjei{ekezxyfmyvwzjzyylfz{egmgeeexfexgzkgkgeggi{{ylfvhvvyzvyfyfzjyym{kkkegzxnmnvfzlfimwxhgvxfy{{kxjvwnj{k{kekzxxn{ggg{jvymhxhkg{yyjyhxhwyxnzzwnkggmekxy{{ezm{gzmyhmgvkkmffejgvwhkgxvwginjzlywxhegfmgizwivjxem{zjzzxyl{{fgyjeiggzlmfxlxyhveg{zfi{l{l{ygmxyixn{jvwhhkjmggzhnfgvmwixxn{gjxkgzw{ijkeejzyjjgw{zfmlxl{hgzzygkekegxywyvjzlvnzzighg{gjk{gjmgv{wiekenfeemnjg{wzhxwfxzyheeviiji{zhmzvzhkggxheix{mzhwyxhzwkkfzxyjmynxhjmzyhi{ejgmjm{kmhkggwnwnylgijmvfzx{lwnyleigmzxzfeekggegzz{yjeghe{gjmwfhvfvnnz{{w{xy{nhkkyhznjz{e{gigxhmwgggv{{nj{wxjgifi{k{kvfmliv{ffe{jjvjikgiz{yix{wxhzzivgmizyfzvfixyzwxywhnjkijkjkkkzzxhyl{jwwznwjgifmkmywhvegfifvzww{zlvhwfmhfixy{{z{jzvfjm{ev{n{xynlwnfggkeemyjxmfnnxhexezeihigiggzhjigvhvmhxniijxwnhmwjkew{{geeylgzhgwnhzzzw{ywmhfewn{ljehxnwxwwweezngefvznnjywgzmfnlfi{jmnhxhxzhnhnhhvyymnywik{zzwzniimfzwhekm{meihz{ywhnynyfejmemjejmv{wy{eeemjvhkmjxjkwnfifggivjfzw{ix{vjmnymfnf{kfijkn{jegxyjivhe{ggmegzwizfejgjm{xnnnhgvjeznzfgmwl{mxhvjexgvjkkgxjylnhgivj{kjikkii{hm{hg{xjivnxjxlkghxzfzzy{eimjz{nwmhxyxjjxjigkxjvhxjkkwwkknj{vzvy{ek{egkkmixjkegnfyfhxwwzl{w{zwyvwgixhixjzzlm{wnkikmke{mwnvwyfeejiywgmmjxh{wxnezeinhzz{zyjfewjwyxn{hylxjhmnhylmfnf{ly{w{{l{y{nw{zjjxgxwjwnzhxhhxjxxwwwhiiewlxlznx{gi{wmwnlmyjkwl{yhxiijznheekkmngv{jvyzzznhzmfyjzlkmvj{zhzyygzny{gyfyfmlje{khizvev{lfmyjkmevxjzvgmxn{zfvmwvfiifmjxfzgxgmwhjxxffewhgx{wz{hejxyleghvnhezfvyfzlixfkzjx{ylivgmfmzlkkixxh{wgekgm{kivyix{kfxwjkk{l{gm{xy{xyyjixjzfyjz{exzzywvymjkkgmwygexjjkjmmhmfhmkkyfwwizxfv{y{gxvjxynjylfkjkzfnfyfzxiigv{{{zggzxmjzznjhgwhm{{wmfgvigz{nlzhyfwf{lizywjxjgjgkevf{hfkxhzhyjgvwjezxnhknwxjivzwjgekjzxnxyw{hgmlhenngzxynjekmhizkk{fzljvzyzhzn{gxlnjjmgieejifgjejkwhjgjkhmjzwy{kkkjizj{j{y{hyhzhmfyhhekmfxzhzwfzgzvffzjkhxjeiinn{jeiwnhievfzhehkxjfe{ejzylyfegzxzj{kylm{nlgmfzw{xf{ggz{yyjegkgznjgmjhvfkgkyfyf{hixzlkkjvyjxnnnznzlkgmwkkwwxfhehxkizznjwfzjekkkiv{gfi{jvy{hxhkmhzyjwwxhwnmjzzgiyfgmfmxy{wgem{nynw{fgmkkzziejgwlww{ymjgiv{mnywxlwfnffezwjeekemgmixzxeg{{fihgeigezlmf{gxyhvek{zje{l{lfegmx{jmn{zjzy{hzzggzh{{gvemmhxnnnjx{wzh{i{nhgjzzwjg{evjmlzx{h{wemgkvhhmxykivjzlwjzzy{gz{g{wgvjmeg{wylv{nfyjkmjgzyzhjznhzykkevzj{g{zxyjvzhgiek{nie{mii{yxhgifzmwjgjmyyjejm{yikwnjgmjmnhehkkihmwnjegizwnnzx{w{fylhvgmmhfveekgkm{wgxyjvlv{{gjmz{hvzlnnz{ml{xynjxkkzyznke{e{ghgexmwzwgvxfnf{wxjiznj{v{kevznivvhkg{jfzjikk{y{y{wvjxhzzivzzezyfmjfixyixxyfxnfkiixfxkkvyxhylwjwwivekmjmwkmzjxnegnfyfzwizzlvf{jmhzxgi{{fvjzvf{x{emfkmxyyhwnvnfveexyjxgmyjxhvfezeiyygimlzxji{ygxmh{lzzjxxjhmwljxw{hkeejgyjhgwnzxzz{njxgkvfwnke{{hxx{gkwwynzngefvzngzxygzgvnlfk{fmnyhwhzhiknhhxnjmniizx{z{hznzhmfzwhekmwfeghz{ykknynnkgjmmljeyfvhwyzxzvmjv{kmhk{ywnvwgmgifkfzwwix{vvnnygmgm{kvn{nn{{wzwjivjhe{ggiegz{iznnhzjmvy{{nhkkggiezhgmwfy{xhvhfzgvfgkggzgxnhgkvj{k{{kkynvjm{mwwwyjimxjgxgkhxjzzjy{ggmjjgnwmhzlezxynngkgzzwxjyh{xxh{i{vwwzhekgiixkmwnjkvjnfyfxl{hig{e{zwnvlgizzixjzgem{wnjgkmjvz{{efkyfvnjiyw{xmjkkfexnezemnheehijiexwjgm{j{hjxxjhmfvylw{mh{lylw{hgjm{nzzw{jxgk{ywnhkxhjg{ixwvl{zieizxlyhm{gihexhnl{kjkfzxjhxikjzfkhmkkfvhg{jwjiiznkemfhzywkmwhzhzwfigzvhyjyfnjnfjeyfhiwy{v{lgknykmzwxjwn{exnmjfvfzfgiivyjxfzzxy{{kgmxfexzygx{leghefzylegjknhezkgjmkgixvymwx{znxngmjvzlkmjixhjkgekg{xkifmfv{kwwwjxh{{{gwjhv{xhvfzxjmjyjzyimzzegvymj{ngmgkgixjixkgmh{xhmkknjww{{xf{vnlgxekvlnjynywjkzxnfyfyhiiigwl{z{yzxmj{gnjm{eifvjimfgzfkz{zvwyyfkk{ljexnjxzfgekewn{hvnnyzh{vgvwjggxnhmzwxjzw{yylikjzhihzw{izml{nzhgzjxzvekmlizxhjmzlxwzzzhxlznxl{zjmzzjmjiw{nfyhjkjgjgzxjzfkgzkknhzjhimn{hgv{zmfnlhegvvhzh{{exgzgifzzymwjexlxl{jynwn{lkmfzgxhkkizv{e{jzxyfhgzhzjwfylm{xngmv{w{kmzlgz{yexeg{fznjgjehvfgnnyf{z{hixjmkkjzjvxngv{{zlyymwkmzyxfie{kxjnhnjfvzyekmfivwlge{jfmxwxhix{yjijgxhggikzzvffvgmekxykmevm{emnwhmv{kkmjixjgvlww{yfegifinhywxn{nfmjvzwzlzlemfimhzxyn{{njyyeiev{emfmhxyyfhm{z{yw{{lkmgmxnxhn{wjeihkgiggimjigvmwmhxniejx{nwj{ijgimjzhijgzvyfmlhxvygznngkvhgxxy{y{wzlivzzzh{x{gjiemjmgi{whzvwnfhimnjgfmzhxnkezygzjgzj{z{zhkzvzhev{i{nmj{mzhhzxhzffzmwx{jmik{hjm{ywywnnlmj{imnhkgkhm{evhgijkfzzxzh{fylmygmmfvfeexfjggzgkyjegzh{gjkz{hvnhnnjixh{xywizkkzhzn{lvw{gigfzmwxhgvkmzf{wgznhnjjk{kexmwivwhfehiwyjikgjg{yyjhxkk{fivwwkmyfnyjzjx{wxyfzyykiwjjkxhhxxhhxwjwwzhzwgivnkmiz{jegwnfehzkgzlvjzhmhginhgvfzjzezei{eevn{jxmywnvnyfeeyfywmfzyxheveveiiegimlynjikkhzmhzf{xxykkhmwfkmw{iizvylgihggixjzzzymjgkzwwn{hexhxxhixzzxyznfzjeznheyw{wjznlv{mfmn{xhxikzxnhhvyymnimzx{zmnznimivzwggn{wf{{hzxhyfnyhmkgjmzzjehxhiwyxj{lmjxnkmhkezwnv{ivgijmfzw{{{{vkgxhgmgx{kvngin{gzvhjijmhewlhiegjmjxfevjjmvnx{nhxlfmznzygmgejxxhvjfzgvgikggvylnhfzvj{kggkkywnfm{{m{hjijkxjgvhkhxz{vyiv{fmjjmgmmhixxjxynwgkkizhxjxlhkxhmy{v{evlekmjixxfjkjkvhnfyfxnivmlizwjzhemvlgx{{hkmfm{wyivkmwhhkekjkjvw{zhgzzxegjmevxnevmy{k{emnxwgexwvfiz{hjxkkixvnyl{eyy{lxwee{lzj{ngivnjxnhekwnvyxhz{zlxwgm{zznvjxlylnjgihzjinlggjkgexfhxigjznhmjkkmnzz{jgi{xiexfmfyfkikmwh{zhzhegznyxhyfgxx{jezwhizxmf{lmjfzkm{jxj{enwxneefemwn{iifigifznjnl{kz{xfvhzygx{hz{hefmylvlwnnhvlkgjm{nixvnznx{hgfgmf{hzlkkjvxh{wgekg{vkififv{k{kekxh{z{gwhjk{xiexhkihzyjjgjizzivvymj{wgmw{fkxj{hkggknfhm{wnjww{nn{v{nngxfenhnjzv{nxnivfv{n{iiixnznvwnykknhmnzhhmzyfvgkv{zhgiz{xj{jjmmy{kgigvnfkmmjzfzhmywfnjzh{zzn{iegxnhknwxj{f{yyligjzhgmyw{{jjv{nexgzxyynek{exyxh{{zl{j{{zhhgznkg{xjmmfgzm{gk{ixfzf{xhxmhzwvngzxhnlzjhkggn{hzynwyyjwymwjv{y{wji{w{fx{vl{z{yii{jz{mfwnhmvyfiylvykiyw{ejvylyf{kzxiikgylmnxjgmex{lxf{egz{{ggegkm{{ylzzhvfmvjyfyhwwixwlkkx{jvxnmj{{igggmwkkwwxfikeixj{fnjwfnnekgvxn{gke{jfkxwxhkgekyjxjxhwyxnzzezkggmevxykigem{{enwhmgkkkmjiejg{vww{yevgifmkmyw{x{nfmwnzwzjhmemfiixzxgz{{fihgeifgzlmf{gxyyjek{zfi{l{lizgmxw{wn{wj{w{hmjggiknfgv{ijzxnhgjxkgyl{ivneejzy{jgw{vfmlhm{hgznfgkvhgxxyji{wigjzzzikhx{zkmjxhxeg{wiekenfjkwhhkgegxikjxzyywkk{fgx{zhghkzh{whxzwywjx{zeximz{vl{vx{jmjejejmfzwywnhgmjmwnwhk{{{v{e{hgijmyjzxiizlylfigmmhvnee{nkmgzimyjegv{{g{jegz{ginnz{nj{xiigikkzhznxngm{gigexmwkigvxfyf{whvjxnjjz{kexnyivfzfe{jm{jixhjk{yjg{wxhevivzzjkyf{vfixyz{xywhynkizfjkkkhvxhylmnwwjmekgigekmizxfegfkkgzwgizlevzhmhzxyw{{z{jzvlwl{e{wn{xyhewnvwkgee{lywgmn{xhfeizei{gjxmlnjji{wwjmhje{xxywhhmfvkmw{yhzvjgnyhgggekzz{ymjgkekwn{hiehxywixzz{mznfzjezn{vnh{whxnlnfxjmnhxvjzhnjnhhvnfmnyy{j{zn{znzhmfzwgkkm{mynhzxhkgnyegkgjmekjeyfy{wymfzvmjynkm{jjgwngmxngijifzgkvf{v{nxhgmmf{kvngin{zwgxyjfehe{gfkegjmnhnnkijmvnmhnhzxjeznxngm{ghmxhfzxhgvwlkggzgxnhfk{k{kmhkkikznm{mwwwyjfexj{yhghxkgzzivzzmjyfnwmh{jezxyvygkkizlxjgziixhem{vwwwnek{eixkmw{jkezjvyfzwiiigzv{zgk{ngigxgkjzzlm{wnevkmjmeg{egmyfvyiiyw{vjxxhizxnei{hnhxjzhyjjiwjgiev{hhmfxhmfxylmjnj{ly{w{hgfk{nzzyfjxmfekwnywxhzy{exwgm{zznwjxlhzjmgiyfnynlmnjkmnmyhxynnjnh{ikkmnhg{jvyiizn{mmfiezwkmgezhhzv{gznyfzyf{xjeyn{ihiwyig{lvhyjkm{hxjzxz{xnmlyffzwwiivyjxfzgmgmwh{mxffegzgxyjegheixylegjknhwyyfyffzixnhzjx{imgmgmfvzl{ymwxhzfxfxlzvkifgnj{kfzekkkmn{gwfeg{xxjxhxjekyjz{ggzzyy{hmjfigmwyxyxjxykggkeihmkinfwwjgxf{vwwgxevywnjzzfkjkixnfyf{viihg{{vwekzxmjiinjxwzym{jkmfkmivz{zvwyyf{w{livvhjxixn{kezf{hfknnzhxyzn{izwxnhmyhxjke{yylhzjzhm{fw{{hml{nfkgzx{nnekmfizxhfgzlkeggzhhkznkgjgjmmfeijijkjvyhvyjgjghmjzvnzykkvjzjxnfg{hxf{zgmkehekmvwzhjkexgzjzfzji{hjegvm{{jigwnhgjkfzkmwwki{e{exnyhyfegvwiim{ylfz{egmwheexfzhgzgxjveg{y{{yljvhvfmixyfxjwwyyjikk{h{xxnhevfigkgmwkmzjxfx{eiki{xnjwhzjekyjmfwliz{jfkxlxhjghzyj{{xhggnlzzwwfegmgixyxjjkm{gkyhhmgzkkzzfijgzyww{yzlgifigxywhv{nnfjizwzf{iemgkjzzx{e{{njnfeifvzlgmigxyyfev{zkk{l{liigmx{fzn{izzy{hmwggzh{hgvwjmhxnhijxxjzh{iylimjz{ijgzvjvmlgvzzgzjggkekigxyzywhigivzzynkk{gkgemjmzz{wyj{infx{jgjgyhzhhiizzy{ekmii{g{zhg{gzhki{i{nny{mig{jxhjmkkfzfkjmiixwjmfzhiwnm{mjmwgxhk{ywnwn{fgijmvfzxzj{fylikgmgmvyee{{jggzezyjvfyh{gvw{nhvmwnnyfhx{xhinhxhyjznkevw{gynjimwxhgvkkzy{wzvnhfi{v{kevznivezjm{jznjixhfk{yyjhxxhkmivwwfgyf{emhxyfexywfnfkizjjkkkzxxhjgwfwwkkwjgifgkmywxyegfekgzwkkzlvhfgmhfenhgvjgjzfefi{efekmxymywn{zfieehkfkgmzjxhvhjgei{hgiggnjji{y{vmh{j{xjxkkhmwjgew{jz{ljg{vhggijkzzzynhgkzfwnjvfihxhifizzikznwlfeznhvgi{wnynlv{nwmniehxzhjznhhvnjmnem{z{zmyznzhjgzwzyyl{mgxhzkkvyny{gyfjmjxjehvyhwy{ezvmjy{km{fxjwnfkivgiggfzgmx{{vylnygmhz{kvwjkn{{nvhyjvlhe{gkeeg{wjxnnggjm{ximnhyhjeznylgmfzhixhexji{{kgkggvgxnhwnvj{k{jkkyynym{hg{xjijexj{yfmhxjgzzivzymjjm{emh{hjkxyeigkxhzhxjzviikk{l{vwwwnekzvjzkmfmjkfejzyfhvvyzlvf{zmhzxgihgjzxww{m{wwevkmje{mwnzyyfvyiiywgmjxkkjxxnvjemnhggzhjizfwjgkik{hxyezhmv{ylzvzf{l{vw{hg{h{nwnkgjxnlekwnwwxhjghexwgizxzn{gxlhz{wgihzmwnljgjkgexnhxigyynhnnkkfx{g{jfk{xznkgmfievhkmwlhihzfzgznynnyfyljejehzhizxwn{lwnxhkmhkxj{egmxneekgmwjeiivnylfznhxn{kmfxfvfzjgxvweghevlylvlwjnhfxyfjmjzixfkzfx{hvxngmfvzl{yfexhzjgexligkinhfz{kvl{ykkzj{gwjhv{xnffzki{yyjzy{{zzxyvymjx{gmwyivxjzlfemhikhmkigzwwjzmnv{nfgxvfnhnjyjfkjk{jnfyfgxiixjemvwemzxmfienjhi{wm{wnmfkmxyz{{ewyyfw{{lizyljxzyn{xnwl{hv{nyzhyhwlwjwwxnhkyhxjzjvhylezjzhimyw{{ljehegkgzjxgkekwnxykk{fzljzvjzhhvvfxlhgjmgihxjinlnfjkfmjgz{y{jzjgzyxhjgzj{jwy{hyhhimfnfhegxnlzhfixh{wzxfzji{hjeiim{hizxwnhgizfzxjwwxjxy{ejxnlyfnnvwiifkylmynlgmgeeekmevgzkkggegzyznjgkihvfiixyfxlwwixwfkkjvgzxn{zznigzfmw{yzyxfx{eiki{fnjwhnjekgzivwlvy{jfkhxxh{y{yyjggxhwyxyzzgifvgmvjxykgigm{xlki{fezkkzz{{jgvywwgxevgivnnhyw{xegnfzwzwzjkiemfmmhzxhm{{fmyneiexv{mfgxxyyjez{zjveehgjxgmx{fen{{fzyhk{fggigjigvmnjzkeyfjx{wke{iz{w{jznyjg{ezjml{nvygzhmgkexegxyjevjzlylzzzh{x{gwwgvjmww{whvkinfxyevylyhzhxngizyxwkmzjzh{zhmkkzhki{i{niv{mzh{yxhjmfzmwjmjmigimjmzy{zwnyfmj{imnhk{yig{ekegijgnyzxzy{vjgikgmzzfveewnkmgzy{yjfezl{gkk{nhv{xnnjgxh{xhgjxkkyfznxnnw{gzlxhmwgegvkkgz{wyfnhnjnn{kfeynivvyjm{jwjjikmjk{yixvjxh{xivwn{vyfxjixxykixym{njkikeezxhvlxhyf{vwwkmwjgizwkmiz{feggeyfzwiizlex{zmhzxnh{{fijzvlje{evjn{xynwwnvnzneeynywgm{kxhvfxneiimjxgg{{jikmmymhiziixyjmhmwfkmw{jz{ljg{vhgwnhzzzgmywmh{ywnjx{{hxiixwzzy{znfzfizn{zgi{wjinlnfmjmny{vjikyhnhhvynmnii{zvwnlznzhfkzwz{yl{m{whzkmvfnyhgfvjmnhjehxz{wynfimmjxfkmjxfkwn{efggifefzgkix{vkinygmvl{kvwevn{gizwjigmhefzjxeghvginnznjmfk{lnhzvjezngkgmwjywxhgkexgvwwkgxjkinhfv{k{kkkkkimvjm{yw{hyjjgxjxhyjhxxhvyivvlmjjmn{mhkiezjxwhgkkiwnxjyhwwkkyl{vmjkmeknfgkkmxljkvjkkyfie{hzlzn{zgkzhgigvixjzjem{gkegkmgeegwngeyfvniiywgmywxhkmxnvhimnhzzzxjigvwjgkfk{hxyxj{ffxylw{jz{lyhimhgw{{nwwkkjx{e{ywnxyxhjky{xwvnhiznixxlie{hgixhjifgfmjkfzxyhxxnjznhiekkwlzj{jfkzzzn{mmfievhkmvjzxzwv{gzfennyfhex{ynnlhizvmj{lmjnyxfvyxjzvgmxnmffvfzvfiifmkefzgznlwh{lxfevkggxz{wfhefzylvh{ynhixfeyfkmixfkyfx{hvfggmfzzlkkeexhgvxfkg{mkivygk{kfezwkknw{gwf{j{xhxfzxjnyyjz{fezzigvygiwygmwy{fxjzjfegknfhm{wyywwjkmn{vxfgxexginjywywjkkgnfz{zwiihiznvwfgzxzz{{njjzwhm{vjmfxfjkz{{m{jjmfi{ljenljxkggeke{n{hvyzvzhnlzn{i{jxnhkzwxjix{yjgzzjzxnhvw{zjml{njkgzxyzzekmfxyxhhxzlxwzzzhzn{gxlznjmgi{wjiv{nfyhevjgjkzhjzwnzykk{{zjhm{z{hgvhimf{lhexhz{zhzwjigzjifzjkxhjeimnnhiiiwnxnezfzmjwwkiyj{ejznwyfee{jiijvylfzzxgm{leekmzvgzkgjveg{yznylzyhvfgfzyfxl{xix{hkkjvkkxnnw{gzlxhmwkkwwxfhe{wkiwfnjwfzyekxlmf{g{z{jvnxlxhww{iji{wxhwnmfzzvnkgmfzwxyxjjkm{mfkihmkkkk{efejggg{xgxmfgifizhywhvwfnfhvzwiv{iemwjfizxyh{{njyyeifvv{mfegxyhzmf{zzyw{{l{jgmx{fin{{lwhhkfgggyyhxgvnnfixnizjx{wwj{ivnhgjzmyjgzxznmlmh{h{wzygkekmjxy{w{wigzfzzyy{x{gjv{gjmw{{wylv{nfxnmnylwhzhjzjgzyxjkmzjjm{zhiyfzhwyzwheyf{mim{yxhixkkfz{wjmjem{jmjxwywnmymjmngxhkzh{v{ejzgijinyzxkkwnylimgmmlfzeexfkmgziiyjvlki{gzywfhvkinnjixh{xixnhxhhxznxngm{gynfzmwfggv{ygz{wieginj{l{kexkkivjxm{hikeji{y{n{yvw{wxhvhivzzmjyfzvjzxyfgxywhgkkikeezkkigxhjg{vwwwnekmj{lkmjexjegzwfvhzgzzlemz{mhw{yw{{{njzevei{eevn{xyyjwnfifveexwjxgmzzxhvf{feimygiggiijikmhmmhwj{xjxwfhmwjjxw{xwzvjghxhgwy{zzz{wmjgkfxwnjxjmhxikgkzz{ezn{ghxznylgi{whvnlfkhvmnhm{wikeknhhxzfmnzjzx{zmnznzh{zzwheyl{mmnhzkmzynymwfejmgzjeyhz{wyxheegivnkm{hivwnw{xngihifzwwix{vvnfzgmgm{kvwjkn{gzvhyjzfhewlz{egzniznngkjmvnixnhmlx{iefvgm{gywxhevfz{{wlkggznlnhfm{w{kzfkkimzjm{hz{hyj{nxj{ykkhxjz{hiv{vmjjkvwmhkeezjxvhgkhezwxjgzwwxhem{v{ezhekgijzxf{{jkvfggyfyjvyzljz{zgiv{giyfixxwwwm{gkezkm{legwnjgyfeeimyw{zmjxhkixnvjzznhmlzhjiy{wjwnhz{hxwxjhmjvylmfnn{lxlimhgml{nw{zjjxnywj{eizxhjmzlxwwnzhzn{zxlhviegiyjnynlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfhxhekmjxzxhzy{gzvlx{yfyjx{jejmhiwywn{lfxfzkmggxjzzvwxnzxfvfzjmiivnz{fzgvnl{kfgxfevzngxyjwfheixylvhxnnhevyfjm{{ixvnzjx{nhivgmvwzlxhexxh{yxfkgn{kifmgg{kfxwjkkxw{gwf{j{xyjfzxjzlyjjm{{zzgxzzmjkegmmhgexjjxm{gkzfhmkgmwwwkgmnv{iegxfeywnjyngijkw{nfzyekiinn{{{zjzzxmhhxnjxn{wfvvwmfkmjkz{n{{zjmgi{lywywjxjijgke{f{hfmzzzhxyznwjjixnxyzwxjwhvhylhzjzhixnw{zlml{neigzx{yjeknhxyxhxjzljxnyzhimvfxlznjmgiemjivyggjkvljghxzhjzgkeixhzjzjhiwy{hhzzhgmxfhekmfxzhkgjigzgkfzjmm{jeywxlhixlwnxnfkfzgzvyxjez{ejznlyffzzhzjfzylmynwgmvn{lxfgegzgxhgegkg{{ylizhvfgjvyfyjwwixw{kkjv{gxngmznzlzjmwkkzyxfkg{wkiiznjgevnekgxxn{gvy{jvyiexhjgekyjhkxhzznwzz{{femfkgxykkivm{mwyhhmxjkkzxjijgv{iigxezginjmnywyhegnfyfzwzjkiemvyfizx{v{{fizneifx{emfmhxyz{eg{zkmzf{lywgmxyjin{xn{w{hizggzh{lgv{ijzxnzyjxkgvh{ijgimjzy{jgzvzjmlgxzzgzjxgkekmjxyjihxigiezzig{x{gxl{gyfzx{wie{infxyjgyljzzhhgnhzyiimnzjmy{zhgjzzhevgxheek{migxyxh{wfzfzwfjmikmljmge{z{ejmmj{gnhhkkihm{ez{giyfnnzxzf{fylevgmmhvfeezlge{wznyjexy{{gjvwfz{gmnnzyhx{xikizxhzfznjvnl{gywxhmw{wgvxfm{{wyhginjjm{kevnfivfzfe{jjkjikkez{yyjhxxhkmivgijxyf{xixxyyfxyfxzvki{nezkkxyxhylwjwwgm{ygimfkmzf{negjkkghzxlzlezfgmhgmnh{{njjzezkg{eggkmxy{zwnfiyfeeyhywgmyfxhn{{feiiggimlzxnfwjnyegzlegylfxhmfz{hyj{gekzzevfxgmhzzzgzjxmhmfegizwneziiixww{eznwfkgjzhgnneexjnlvwmfmnhxjgy{mnjgeigzmnem{jkkeiznynizzwizkm{mxwhzxhkgny{xkgjmhkjeyfkewymjeemjmwkmhkjgwnwygmgijifzw{x{{v{nxhgmnl{kvwfkn{gzgxyjjehe{gjxegzynhnnjejmfkxhnhhzx{znyfgmwljxxhfvjigvgikgxjmynhgm{w{kzlkkyw{hm{{m{xyjggxjxlznhxw{zzivw{mjjmywmhjeezxyfkgkxjzlxjkkhkxhjg{vzvy{ek{xixxfggjkezkkyfxh{higw{{zgk{ngixfgkjzfem{wnkekmjz{mwn{lyfee{lyw{xnhkkwwxneziinhnjzhjikmwjgkjk{hy{fxhmjkylmfny{lhvw{hggi{nwyw{jxzzekwnwnxhjkywxwgkhiieizxlhvxlgimlnyfgfejkfxhvhxyynjnhnwkkfzzv{jfm{hznzxmfyjwfkmwnzxhzvjgznyx{yfgv{kimylfvxwxhnwgifzxfyfwwvl{xvf{zwwnyvfiivnz{fzn{nyfvvwivwlgzgxvwz{{njivyvjz{{wzlyfyf{lixfkzxwnznjv{efkzl{njvjkzfgexlm{kifgzv{kwh{ykkyl{gwhiv{xylexxjxlyjhxjizzywzjmjkggmwyfkxj{lkggkzvhmkizfwwkkjgv{gvgxvhxynjkmgijkvfnfjmhmiiynem{zfkzxgizznjjz{wm{ezmfxfgez{wn{jyfz{{liznwjxkin{xngk{hnhggzhjivfwjfmxnhkzwxjhmzwylnjjzhiemxf{{wyikfkgmmjhiwnzzvljmvln{feww{n{xfkhxjvgxnyyl{ifzzjmyv{hv{lnnmfnhkegvwjgxzw{jei{veeznnj{fgxv{njkiji{wexfzjim{jeynnnhimfwnhgkmfzyyzjxjnl{ekeywyf{kzhzjfxylmynlgmjxw{xfwjgzgxyjeghe{gylezhvvyvjyfyjwwyywjkk{h{xxngvvfigzfv{exikimyjgxgxeejgezki{fxwiinywf{jfkjxyy{nimjvjvwywnhkwwgmhivw{ljg{wwwzhzzmyhmywmlxyzlhmv{nnzwkegiv{y{ywjk{nnfhvzwivhmemwyjzzxzv{{njhkeifzv{mfzvxyz{{z{zz{{l{lkegmhgjen{wjw{x{fxxh{zkmvhm{em{fikiekijeznjm{ehknfxyy{ezjexlemkknlgkfeegxyw{hxzlxwzzzh{k{gzjznyfzv{wyf{infiejgjgjzzhhifxzyxlkmzjnj{zhkmn{ywyzvzwmj{jeekgimkiezxhxyjmyy{hjmjzmligmwvyxheeyfkgvhgmyjnnkgnnzxizv{gxhknhnnvywfzyn{vjvnv{kgz{ee{jvhwj{nfxjz{iggiggeivfehgvh{xkmeijejmgxz{kiyyeky{jegk{lfzw{njivvjjmhi{ljikk{n{yjgwhxhvlivggivyfmhixjxfexywjynkifzezxhfmxhjg{vwwjgzwmj{ikmywjkegv{yfzwwyzlvlfkmhgkywgvgijzevfm{e{{iigexfgxzhvlmnhgzjyhy{wyvjjxkgyjnhggzhxliinnz{fxegiifgzlvn{weezvhixneghgeggxz{{hjgmwmfekfkvwx{xyxwww{gznwlimznhvnh{wxhnlvy{nmngxvjzhnfnhzykkmny{{z{z{hznzhwyzwznylwfmfhz{{igexmh{hiemweieifmmhnlnwfkyjzxggynfevwvjnlxlx{gkfxm{kmyjgmgm{kvnizn{kizwyjfxhefzylegjxgifehzjmvyxlnhxljeznfmgmgekmxhwhfzgvwnmheieezlfijefz{w{eivkeeexw{xyjggxjxhjiwljgnnxfzn{{jkfeekxyezxyvlgxyyixvyxlegzl{jwfnhgkmhhegkxf{f{vexwnfxylwl{vemz{ixfmy{hvixxw{fm{gk{zkmjzegwnmfyfvwzvywegnhkkjexnvfjenhmlhijiggwjmh{j{higezhm{xylzvmh{ly{eehgfg{nzzgzjxmhwj{evfxhz{hmxwkg{zznvlxlhzxwgigzjifgw{jkwlmyhxhmnjnhhxkkgeem{jvyiiieiimfzwgkkmevzhzwfegzvlynyfnlmwyn{khimlez{lvlfzxf{lz{fmjeexmyhinjixezizz{fzeexn{k{kxfexvjgxvwz{{nnlylvlxynhvhfvjmvwixvyynx{gxivgmwjzlkkfmxhjmevkgzlkinhkg{k{kekkkmy{gfxzx{xxlxhxjeeyjz{{wzzhmzjmjxwgmwyivxjzljmmhekhmkmnywwzwxf{vyygxexnhnjhzywjkm{nfz{{eiizlzn{zekzxzviinjyf{wfvzfmfxjevz{zx{zyfvw{lywvwjx{yn{xnwj{hvyvyzhyyznwjwnxn{hzwxjzh{yylfejzhi{jw{jvjv{nnhgzhkxlekgxfkxhkkzl{lnnzhx{znkg{gjm{eemjigkggjkzfjgz{{ejzez{kkk{vzjxwwj{hhx{zmfxyhexhgezhfgxh{wkgfzzwmhjeigjmhimlwn{ljgfzyfhkxjgx{e{jyhyfnf{jii{vylmyyhgmwlw{xfjegz{ygkegkg{{ylzfhvfmzzyfhv{hix{ekkjx{kxnmf{{zlxhmw{yvjxfy{eikivynjfxvnekyfiv{g{f{j{x{{xhxj{yyjfixhwwmjzzfifegmegxy{whzm{nlmyhmyhkkwwjejgfkiigxw{gifmheywxjwfnfwhzwzlzxemfkmhzxfm{{fgyjeifm{fmfiexyhxgx{z{ww{{lv{gmxyien{jvei{hgiggikjigvzxixkezyjxkiz{{ijiw{jz{ljgzvvnmlywvygziigkfehmxy{n{wzlwfzzikyf{gkgemjmmh{wyjivnfyhjgyljgzhhg{ezyzxevzjjk{zhiemzhwyekhe{i{mimv{xhivnymw{jjmii{{jmfvhi{enwmjmnhehkjehmwnwjgijix{zxkkwnjghigmzxvfeejekmgzfzyjfez{{g{jwfhvnhnnzwxw{xiigixhezzn{hy{{ghejimwzlgvkgyn{wzxgifimn{kvfyjivvjfe{j{kji{{gm{y{w{wxhzzivwnezyfeijzxyivxym{vjkiwjezxhigxhyl{ywwkmzwgifikmywmfegvnfvzwiizlvjzhmhgkxy{{wljzeim{{ewyylxy{jwn{zkgeehijxgmzlxhevxneiyynhgghiji{{evmh{j{xjxfghmwjgew{xwimjgzvhggg{mzzkknhgkizwn{hiehxhexwwwgzznfz{wznhiywgzx{nlv{nwmnhvhxzhzfnhyfzfmngx{j{zywznzhekzwzwyl{m{zhz{yvnnym{kgjmyfjeyhy{wygzimmjnfkmhkxjwnvnxngifvfzgkii{vjmyjmfyw{kvnevn{kigxyjvjhewlhiegjkizfe{hjmv{{lnhyfjeznfigmwlzxxhwhxh{{vlkggzzhnhex{k{kjzkkynvjm{{g{hyjikxjxlznhxgizzivgmmjzwzxmhwlezjxnwgkgvzlxjimhkxhhk{v{ez{eknhixxfgejkvlzzyfyjwwzlfx{zgggigiimjzxweim{wykikmiv{m{egeyfvyjiyweknhkkjxxnvjiinhnjzxjiwwwjgi{f{h{ixjhmnyylzvhg{lnfim{lkk{nwwwhjxmfwjwn{lxhhxzxxwvnzxznznxliemwgiyfmwfgz{jkmnmjhxx{mhnh{nkkwlgz{jfkiizn{zmfievwkmgehihzjkgzexnnyfgxnfynm{himlmj{lwwfzkmzjxjwnn{xngifefzekiiv{ylfz{znl{kjmxfvhvngxfgwf{nn{ylexxjnhw{kgjmmyixvynjx{xhivgmvjzlkijvxhzyjgkgekkivy{k{k{k{yxhnw{gwjxn{xyfxhxjgvyjhxfezzyy{hmjfigmwy{jxjjvm{gkzzhm{wnjwwzyn{{vvlgxexginjhxjxjkz{nfyfheiixjem{zivzxzziinjhkeim{kmmfxlizz{nlwyyf{h{lje{ejxw{n{keez{hfmggzhgzgvwjn{xn{hnhxj{n{yylyjjzhixnw{jvfm{n{ngzhkvneknfxykkwlzl{fzjzhx{{gkgyfjmmfeijijmggyhjmjgzyywjzwn{kkkkmzjxwwf{hgzzxmfmhhexhnhzhhzexgz{ffzyfjmjegvxl{jmfwnhkwnfzgzwwkigz{e{hn{yfhizxiivwylmwn{gmwh{lxf{egzkgjzegjkvfylvfhvnh{kyfyfzjixfvkk{fzzxnzxvfzlwymwkmzyxfiehxkimjnjwfnfekieiv{gkg{jvy{hxhzl{yjiznxhwnmyzzwyfegmeixykggim{gkkihmzhkk{e{wjgjkww{y{ngiv{nhywyj{nnf{hzwii{vemwnixzx{x{{fgnyeivhv{mfzjxyz{{v{z{nzf{lgvgmhk{{n{wj{whk{mggikm{gvmwjzxniijxkiyh{i{wimxwyyjgzxvnmlhzzzgz{kgkvhikxy{{{wzlgezzimzv{gww{gyfnh{wylv{nfgxmnjghkzhjzjxzygxjgzjn{{zxngzzhwy{ihemn{myy{fxhgznymwjvjmyy{hjmjv{z{eywmj{mgxhk{wig{efxgiyfynzxix{fylylgmgm{weejmjg{wz{yjegwf{gjkz{hvfmnnz{xl{xyjizkkfgznkevw{gimjimwiggvkkm{{wyjiznjzl{kexnfivjzjmhigmjikmfx{y{nwhxh{xivgifgyfmnfixyvjxywfzzkikejkkkhvxhhxzlwwjeekmjgmkmyw{jegfmkgzwexzlvf{fmhwwyw{{myjzvlix{efkmnxyyhwnvwhgeehmfkgmmnxhexezeixy{nzv{enf{yynekzjyljewhfvfk{hyly{zyhzyjhgwwignwz{ievnmlgxfekgwhnnznwhzxxw{zwnmjyhzveezxjkwnmymnhkz{ny{iz{nwxljgignnzvmlnlxfvnmh{yikfxikhzkkevzz{g{hxl{heinngkvfzvek{vnwikiew{yjex{hylyfx{fix{{vkenygmee{lkevfki{njexfm{ggfi{{jvfkfivjvwjmfgm{nhyyzyznevgzge{hwwex{nizznmjyyxj{hnj{k{kjvkkivwlzhyh{n{egmizyjvwgiwyjg{jei{wkgimzwxyy{{fvwgkgvzwxjmlhkxhyh{vmjvwek{xnjxf{fjkvhzzyfhxwwzlzh{zgkvwgimhjzxwgem{wwmfkmjvhewnfkyffix{ywnymjxhzlxnvjeenhm{zhjivfwjgmiv{hhijkhmekylzxmh{lxhee{lwy{ngiznjxee{y{eevxhjkkmxwfehiznvlxlie{hgixfnynljgjkgexfhxhzyyfkjvkkwh{ynf{zhigv{j{{xhgkzfvh{{xfjgjkww{gxlie{xxh{jwfylwnzffknynl{f{{x{nhivzxxwmhjm{hwlkivnmfhg{lvfjkmffk{{kkfvjmkkvnwfhvzyexkgxhwwekgehzvlhgieylnhhmzl{xjezfiiikjemlgikgwlfv{lyfeiwjm{{vgihevhfkik{nz{z{{yxjjxvyvjgvvfzjvy{lfvvjzxzwimigylkgkewjiiivggzxfvy{gvxnegfmfezwv{yn{jfvvykmzvxhjkx{kiwhw{fkikezxlmjwhhg{gimzlmnikjen{xneimywfyfiihvvffkfkjvywy{y{z{wlgmyjy{zxy{y{whje{nzzgmhghv{{{mznieyhgxhzzyzhxl{{kgnfjmmjjmjifkjvyhmnjgz{hmjzjg{kkk{fzj{jfk{hgxzhgmnfhexfv{zhfiji{wwlfzzwmhjeeijmhivjwnxnkmfzyjvyxjgg{e{hvlyfeizhiijgylfzyhgmfxeekmfegz{njvegkg{{ylexhvfmjzyf{x{xyy{hkkjv{kxngz{gigwj{lzjiziky{igy{gmjmzlevizyhikvyeehxwjzxkgznhzjifvwyzzy{jefxxw{xnyjkzhke{vzvigzhigmfiiwnzzgkmlz{znnlwlie{jylwffmji{vje{{mffvwnfeiiyy{m{vfewhjxwygxjijzmf{zkk{lhgvfgzhmvhzwjiggywznhegzzxyynnw{jxjky{jkexezfieexweijgmh{lzjhvevjghzgxginj{lw{hkywkevh{njz{gjmyhkigvim{l{{{y{zixmngmn{zvzymfhvix{y{zjmhk{fiimf{j{ygvvn{yxyxhwnfzmwww{xnfyf{kjzzz{vhkkgfzjifzwwnyvwv{gijgfzzx{wfxkmnwgxhiizjmjk{hznwjyjvfzh{gz{eghvjxnnyfhx{xgvizxhjgznkegm{gzlxhmwzngvkkgv{wxjizfiiz{kvlnyivv{m{{jkmjixhxj{yjxhxxhjmivgmfkyfmhmhjxywxywhyjki{lezkkeexhjg{nww{yzwgifvkmje{negw{fezwx{zlez{nmhvhnh{{{njzvjfi{ewymnxynwwnfmgzeeyngimfjixhevjgeihzgimlmwjigvevmhxniijxwnhmwhhmw{m{eejgmhhggg{mzzkijxgkexwnjvjmhxiifizz{{znwlfiznhknhgznhnlfixymnnfhxikyjnhhvgzmnxyzxvwmnzniiezzwggkmwfeihzkkzfnynnfvyfigjeyhjxwyml{lgiynkmjvfkwn{eivmjjvfzgm{h{vjxfzgmyy{kfi{nn{zjwjjikghewhgmegjxizfefijmvwnjnhzxx{znw{gmgekmxhfgxhgvvlkg{wkinhnj{k{kekkkivvnm{hgzjjikkxj{ygvhxkkvyivnymjjiyhmhkeezxykggkhejxxjxhiixh{v{vwwwjekmjixkmkgjkfevnyfhewwzlwf{zgmn{giyjgkjzwhm{wyevkmjkhewnvyyfvn{xywmnywkkzvxnei{hnhnfzhyjvjwjwnez{hxnjk{fvjylmfzy{ljgimhgn{{nzzkkjxmhzwwnkixhjky{xwvf{zzn{zxlhzjmgihexhnlmnjkfz{jhxxnmhnhxlkkgezz{jfmzzznn{mfyjzhkmvfhihzzfgzvfyyyfnjnfjekehimfev{lggnyxfjxxj{ez{xnmlkgfzfgii{vfkfzzvnl{keexfexyfgx{weghejiylezwynhizkgyfizixv{zfx{hgivgm{gzlkgfixhzyevkgzlkifmkg{kwj{yxhxy{gwjhz{xeeexxjgxyjzwjezzivzzmj{{gmmhezxj{hkggk{ehmxjyfwwkmxf{vnjgxvhnlnjkmywjkixnfyfzwiiigzn{zzwzxmfiinjhgwhm{kmmfxfevz{{z{jyf{m{lywnhjxzljgxnzz{hfkyfzhx{zn{i{lxnhiylxjfv{iylmjjzhgmnw{zhfm{nv{gzxyxlekmlizxhznzlxwggzhievfxliejmmjjejifmjvjkvfjgjkhijzfizyxhfzzjhkfk{hhzzhmfhehexf{mzhfgjigz{{fzjmx{jejem{hiwywn{lwyfzgzwwxjmh{exnnlyfmhzxiigkylfzylgmwj{lkmmhgz{wfzeg{y{{jgv{hvvnvjyfxw{xyyjgkkkegzxnmlvfigjkmwkmzjxfxleikivnnjwhzfekxfxn{ggg{jvy{lxh{y{ijiwhxhwnnlzzgmyfgmwnxyxjezm{mlnwhmw{kkwwxhjggiiigxfzgivwzwywhgz{nfwyzwiv{iemjgjzwyhx{{vwzyeim{{egmkmxyhxwn{zzwzf{ljegmjxjmn{{h{w{hfvggimxlgvmwjzxnjxjxkgyl{ijiw{jz{kjgw{vjmlxf{hgzjigkvhmjxyzfhxigkezzyykk{gzhemjmez{wyjkmnfjkevjgfkzhxw{mzyxlevzjyl{zhkyjzhvygxhenw{mig{nxhzwkkfzkejmik{wjmwlik{emhmj{mgxhkki{v{efkgijknfzxkgwnylnlgmgmzyee{{kmgzkgyjegv{{gyleghvjgnnjmnn{xhgjxkkwjznjzyw{gx{fzmwyngvkkgz{wgxjxnjmn{kvhmlivfxfe{j{ejikmjg{yz{vjkkwwivwyevyfgzmhxyggxyfvnykijvfxxhnjxhjgwywwivwjgijzkmizmjegggfvhzggzlvlfkmh{ngigvjmjzvjkg{eezmnxy{wwnvnfzeehifkgmigxhn{gmeixyizggmljikmfkmh{f{xjxyyhmwjzww{hi{ljgnhhggg{mzz{yjxgkvhwnjvfzhxxyfizzgvznwf{wzniegi{wm{nlfkmjmnxlhxikeknhyhmlmnyy{j{z{eznimezzw{yylwfhkhzkikknyfzfvyfkmjehvzhwyzv{lmjmykm{hfxwngkgmgijefzw{x{{v{nxhgmhi{kv{fkn{ggwjyjzhhefzz{egkiginnjmjmfkimnhgxjeznjegmgejxxhfeexgvwwkgheyhnhggzy{kfekky{{{m{xyzjjijexjgxexhxzw{hy{jxmjzwy{mhizfxjxjzgkxjvlxjgxiixhjg{vmlv{ekmhnjkmjkjkeggkyfhzwwzlwj{zmhzhgigzjzjz{lm{w{ivkmix{mwnzxyffgieywmnmjxhjzxneix{nhnlzxjixfwjgmev{hmwjk{fjgylmjyy{lylhghggi{nzzzjjxgvwjwnv{xhzyhexwvhhiieivxlyhx{gigxjifgwhjkwlmnhxhmmhnhyfkkgeyy{jvniiznmlmfyjzlkmfg{zhzezgzevfzyfxhx{ynkehizz{z{l{wnykmhkxjwnzwxnmjfemwgkiiv{gefzzvy{{kfixfn{vygxyj{nheemylvhjgnhwjkgjmfiixvyznx{hexngmjgzl{yjexhz{evkgyhkifg{k{kjvzwxhnw{gm{{j{xjixhki{eyjzwjmzzyw{hgijegmgmjgxjkefegkyjhmkizjwwjgxf{vfkgxek{enjxljxjkzxnfjkkeiiikzn{zegzxgiemnjjzwhm{{vmfxhevz{ml{jyfwn{lizyljxkkgexn{k{hfkvyzhgzvf{ievxnxyylxjwhvhjgikjzxymjw{jejv{n{ngzjxynek{eizkkzwzljzvfzhyl{{xl{vjmmjeejigkjejkvljghxzhjzvngzkk{kzjhi{j{hyl{zmfiehekmnwzhzwexgzkgfzjkhxjehkm{hifiwnhmjgfzzxvykihz{ekeywyfnhzxii{mylmngmgmvlw{xfzlgzkmfzeggg{{jgkihvnhvjyf{zwwixnhkkjv{gxnzv{{zlivmwkkvjxfhe{kki{xnjgennekxlmf{gnj{jvyjixhix{ijiwlxhggxfzzvnkggm{nxy{nfkm{{xmyhmggkkwwfejgv{{x{yvjgifiywywhxz{nffgzwzj{iemw{jzzxmj{{fizneifzv{mfn{xyhvgx{zkmeehgexgmx{exn{iz{w{hfkggynnfgvnlmhkenjjxkihm{ijvhgjzeejgzxzymlhxvygz{igkevigxywyvjigvnzzzhyj{gwygvjmgi{wyjjknfyljgjgznzhjzkezyxlmnzjii{zhkhgzhvwekheee{mikjgxhznfzfzxwjmyn{wjmzyhi{eywmjfzmnhk{wig{eimgijg{kzxjezlylmhgmgm{keexfn{gzwnyjeghe{g{y{nhvkennz{{w{xxwgixhhvzn{hyh{ghefzmww{gvxfny{wxlgifi{k{kekyyivwjfe{jmwjikmiv{yjm{wkkvwivwywyyfxjmhxyvlxyfzyykizjjkkkeixhjg{jwwgx{ygikgkmywnlegv{fezwfkzlem{jmhfgnh{{jkjzeiix{ewwmnxyxhwn{zyfeeyygigmmwxhvfikeiyjizmlnljikievmhjv{xxywfhm{iylw{jz{lylw{hgwyegzzgzjxgkezwnxyixhxxjxwzznlznwjfiznyjgi{whvnlnfjkmnievjzhjznhhxnfmny{zx{z{vznzhfgzw{{n{{mn{hzxhzjny{iyfjmzxjeyfkewynjeemjnykmjvfkwnkixngiwhfzw{ix{vzyxhgm{v{kv{jkn{gizwyjivhefzgeeg{wiznnfijmvynnnhxjx{znyjgmwlkmxhmwxhgvizkghey{nhww{w{kwjkkimvjm{yn{hjiznxj{ykghx{wvyivgkmjjmvwmhzlxjxyvlgkxlyhxjxjiikky{{vmfv{ekxhixkmvljkvjfzyfgziiigiz{zgkvhgizzjzxw{nm{gk{zkmjx{mwnvhyfee{lywekywkkmfxnevienhzxzhjijgwjgk{f{hywjk{f{iylw{yn{lxjhghgez{nzzvfjxmfekwnjzxhzy{exwexhiznfkxlie{hgihkmwfg{mjkgehvhxzhmhnhhvkkmnem{jvyiiznynmfiey{kmfkzhhzivgzfe{gyfnhx{ynmwhiwymf{lvfxhxfyhxjwn{exnzzfvfzw{ii{vfkfzgmnl{kfkxfn{kggxjgeghejiylvhxynhzjfvjmgeixnhznx{xwxngm{jzl{ymwxhzwjgkgyykifkjz{kvfekkkny{gfziv{xeeexkiyfyjz{{wzzynzzgijxgmwnezxjzjjmgkzvhmxjmlwwzwmn{vemgxekyhnjkmywjkzznfjmhmiigvznvwekzxmjyl{iynzvjzfgkin{yjhewn{{jzgm{kywiizy{yjzhvjm{hfgynzhyjkifgv{wjmjjivnjzjejxhe{iy{{kimizgmxfmjggzznyek{mizxhhxnnjgegnjyhixjmxl{xiieijifiv{{kwfjgzwhmjzgi{kxhzwzjxn{z{hnlzxzn{ehexlvhzhhzkijgkmxn{ngxzzyyyjy{eexjjifgxh{eyfhvx{fmezexwyfzznje{vvymweeik{kwfkmzlix{nixgkhefxgigk{fizex{lxl{giijgzxexjvfkzv{xy{kk{fvhjgy{hegvkiwfzwfmez{yxjynfvvymnzjmwfzjkxljvvnixfkkknwexxwnhjgwhxjvn{xmjivvhgmyyiiv{zzwln{zw{y{xwyxfivhzegnfwyzwiizlemz{ixzxyy{{vwzyeijzzlmfiixyyfhz{zznee{lwlgmx{fzn{jxzyhkwlggiimlgvnfmhxnjkjxkiyh{ijkhgjziejgmhjzmlgvzjgzmwgkvhmjxy{wvjigzfzzikem{gjkgvjmgv{wyfjknf{xevjg{wegmhfg{lylzhhgzfwfhkiem{wymfheyy{jnjzwevkijimwhmjmjeeg{ijzmlevke{wnhjijgxjeivh{hxfjmgxnyzffihmekgmzzvyeewyzzzfxljzwwimnjfkmhgzkinnz{ie{lhenhkkvyznxn{e{ghkfzfzzygv{wnnhzzznhfizl{kekxhkmjzizegnheey{yymjjxwnylgkigwnny{wgzemjkfxwhfkev{kjkkkyjegw{mnmjhkizwnywixii{h{gjvvwjxyhwfgxzvv{ekwwzvmfwniivj{fnnmfxlge{hgx{jvlw{xnzfnwyhggevvnmjhg{gvfxyhxkinfz{izhvhmgmwj{yjgvfxhjkxf{vfxggnnekgznnnfw{xljmzl{lheievfkixffmjezn{xxygz{jnlvwxnmngzhxiknlnhyfnfmnxw{z{zjiznimfgzwzymn{mxfhzxhvynyfzfejmnwjeyhylwymjimmjylkmhkxjwn{exngikifzwyw{{vjgfzgmxl{kfgfgn{w{vhyjeggiwljgjm{wvngkjm{x{h{mfmkk{j{gwjn{evjxxhvnkiznivzxhxzvfvnjv{vnvfiizvjkjihimniey{xjxlgghxzjvl{yek{{z{imemkeiggevwgvki{nwhgzhkkkmh{vwwfijvzxfvzvhe{vvfwjvlx{vyzlem{zwyeeezik{m{zzlfmvjzf{x{fhkmjzyv{w{y{xlzvhmzlzxwjvhylzjmj{zyj{{xnvlzyjm{m{{zwwhkenw{mnw{znyjkizyfvfginlzvfemjvyxhjgywxw{{{zznwjxlienngiylmwfg{mjkgemfhxzhyynhxjkkgezv{jwwzzznegmfzwywkmfz{zzwv{gzeznyyfyljejemwhimhik{lgmyjkmzfxjmlv{xngifefzkkiiv{gifzmjnl{k{fxfezkkgxjkeghezhylvjjgnhnnkgjm{xixfkmwx{yhfggmjkzlkmfexhkijgkgjkkinhix{kwjwjkkii{gm{hz{xyfexxjhvyjz{iizzivzzgikggmmhxyxj{hm{gkzzhmxjyjwwkmmn{v{zgxvfv{njxngvmyjvfv{lx{geimwymfz{vwfeyljvxwmfwhmlmfxlkijxwnkmjzfiyhfmhgemzyvhyymlm{nhgxnjxlvf{innxnxnievf{hwhkmxl{m{lem{ehgezeg{{zjhzynekxjfkxhjvnnzhjkynxjnhfemfx{nyimjiznggyhjknhwhignfv{hmgvnfnwyykgmjxl{gezgzgkylwfigzyivvjexnjkeiejeyymjylemxhhgvfigxfvl{nxjkgiveexymyz{{{jivwmwmfhgvlzfkmwngz{nfzeg{wznylfehvvyzzyfyhzjixz{kkx{hkxnzxvfzlgmmwxhvyxfyjeikimlnjwjvyekkkivwlzh{jvy{hxhkiekyj{fxhwwikzzfmfemfegxyxjfkm{mhnwhmjgkkzzimjgfgwwgx{{ginjzhywxfwfnfxjzwiihmemfgfizxnj{{finyeivhzlgmhzxyz{ig{z{{zf{lzjgmxyiin{kmzy{hkiggiixhgvxwfixnhzjx{wwn{i{hw{jzhzjgzxzymlxh{hgzhigkekigxyjkwhigjezzimyf{gznemjmzv{wyj{mnfyhkmylxlzhxwgmzyhejgzjyl{zhkjvzhfmekhemh{migwjxhggfzfzjgjmjemljmkeikwniimjmwnwhkkkigwnvygijmxhzxzh{vylhigmgmvyee{yn{gzw{yjegvl{g{jeghviznnjm{h{xhgjxxhzwznxnzx{gzlfzmw{ygv{{zf{wxljxnjjg{kvfynivfzfe{jwhjixh{y{yjkhxxheiivwnevyfxhfijxfexyfvvnkihmxjkknnxhylzlwwznzwgizykmje{negfgfezwx{zlexmfmhzxgi{{kejzvjex{emfkmxygxwnfiggeeyyjxmfz{xhvj{jeigzizml{ejikimymh{j{xjxzyhmfzylw{hveejg{zhgml{nzz{hnhgk{nwnjvimhxhkixzzgvzn{gixznyhxy{wyfnlfkxymnhkvjik{inhylkkmnyy{j{zyjznikkizw{ymn{miihz{ygznyeifeyfigjehvhiwy{ezvmjxnkmhkxjwngixngiwhfzzxje{v{wnymfhx{kfgxfn{ixvhyjwwhewlhiegjmiznnx{jmvyx{nhyfggznixgm{ggxxhwjfzgvwnkg{wnwnhwl{kwh{fkky{nym{hk{xjizyxjgxjzhxkmzzivgimjjky{mhjgezjxzwgkxjvlxjgvwwxhhx{vwwylekmhgkkmx{jkexjeyfyliizl{h{zgmzhgiylnjjzwjm{{emfkmxyz{wnjzyffkzvywnfmjxh{exneiemnhmjhijijgwjmhjg{hynjk{fwhylw{jz{lnhhghgfg{nwwvyjxmhwjwnwfxhzyzxxwzzhizn{gxliexhgixfnynljzjkgehzhxhkjznhegkkwhkk{jzniizneimfzwz{kmwfzxhzivgzvhyjyfnjnfynhvhi{emf{lgkfzkmzjxj{evlxnzvkgfzkmiivyylfzmhgmwhwfxfn{zjgxz{z{hewfylfewnnhixfeyffkixv{gzx{hkfgmf{gzlkijvxh{njgkgynkifmvn{kwf{ykkx{{gfvhz{xgzxhkigxyjz{iizzxy{hmjv{gmgk{fxjkejmgk{ehm{wnywwivxfv{iggxekxfnjxjywjkixnfyfzwiiik{{vwkgzxmjemnjhizym{gimfxfgiz{wn{zyfke{lzl{ejxzwn{xnzf{hnhx{zhyfwlwj{{xnhmhmxjwj{ijgvhjzhi{fw{fxfm{ngmgzjxyfekwnxyxhfizlxw{{zhgzvfkgzvjmzz{kjiwnjejkexjgzyhijzwnzyxhzyzjx{mf{hxjzxgm{mhekmz{zh{wjigzezfzyfiejeikxlhivwwnhkezfzkmhkkiyj{ekev{yf{i{jiiv{ylmwvwgmwfeexfzhgzgxfzegiz{gylexhvnhvfyfgv{xixwwkkx{{xxngm{gigggmw{nzjxfxf{kkivynjwhzyekheiv{gje{jvwhxxhjk{ijijzxhzzmfzzggfvgmzhxykiivm{mhkihmw{kkmj{wjgwlwwgxzwgifgywywyj{nnffzzwivhmemjmfizxzv{{fgyjeifz{fmfzxxyhvfk{zzy{l{l{fgmxwfzn{{l{w{hwyggzhmlgvwjmhxnnjjxkiwn{iivw{jzigjgw{hgml{nvygzy{gkvfegxyjiwhigexzzzhyf{gkgemjmnf{wyjnlnfhzmnjgvnzhjzjxzyxlmnzjhz{zxygzzhv{ekhezj{my{wjxhkmkkfzyfjmynimjm{lwywnimmjm{n{hkgmigwn{fgiyfnjzxkk{vjghvgmgmnjeekmjggz{jyjegwy{gz{eghvfgnnjmmw{xyyizkkwlznkevw{gxjxhfzyygvkigz{wxhjxfi{k{kevzfiv{jjm{jfkjikkev{ykgwhkkggivgimjyfmfixxy{yxyfxxwkiivfxkkgvxhjgmjww{wekgi{lkmzfxyegnfyfzwfxzlvhwnmhgmyw{{jmjzezwl{ewwkmjxhzwnvwhgee{lfkgmmnxhexeveixnjxml{yjikm{vmhzl{xjx{{hmgegiw{yf{lylyhhgmlegzzkmnhgkgiwn{hexhxhefizzkkzn{gjeznyhxy{wgznlfkmfmnxlhxzhemnhzynfmny{ik{zywznzhkizwznkmwfy{hzkmkknymnfejmgvjejmhiwynjzvgiynkmjxikwngggmgi{hfzw{wh{vkinygmxj{kfkivn{jegxyjw{hewhzweg{fwffzgenhwleg{fkkggievfgxwlxhy{fe{nynvy{ezjim{kv{zywh{nzxxnwlji{jvwxwywwwhzvhezjkjmigekkmfvn{mhkijejgwjgvhejeimimevjihmjkiijmzx{ekmgxhejkezmnwhhzgvhiixjivwwngxxfkmnj{njxvf{l{gxyjzvjwwjvmnnlheeinnkgkixnei{hnhnfzxyjyywjgghz{hiixjhm{hylzvhgnwx{hg{lvjmlwnigemmh{lhmhzwykinfylgg{ghknjwy{l{wgiyfhgv{m{{vevgvkmynhmv{hg{efznwnyjmeggvxj{{xygkizvfhizwzlgzfehzxnjmxjjxiefznjzx{xwnimiiizgmhxjijigz{hnygivfzj{wvn{vy{{kzxgijxhvfezwmjywwhkefvzl{mevjxmhz{ekwj{vhvgzvhnl{yzlxhzwik{yfizjheikgi{nkivfgmyjmh{jvnm{kmji{n{nxhvnxywjzfxffekmgggmmhkewhkezjzzjmji{wizylxhyhfzwwggvffe{nkmkmgvv{zwjiikgznw{j{nfewwginhzf{gkiee{hwwivxyiezvwyjvfi{lywmfnnw{jifgwlhiiznfimylgemynnjghvjiiifvvhzwgxm{nyhvhgivnwjkfm{ynhxwwjwniziigzigvwvjkkhvwfjmkk{xvfnljznlnfmjwjhe{jzh{kfmhizf{jxnikwnhxyhzxwnmy{fn{{jmfhzkijkgifzz{ynkgny{jjmeexlxyvymwyyie{ymhv{jkhxvjhgix{wjvzwekxjikwwzf{yzngmiv{njzjkixfkmhhvfkmjhmxlwf{{eziijeiew{zxfihm{nkezjgefkynigimfzz{{xnnekzxmfwlzh{kgijxvfkixljvgzw{zzeeeggiww{enwznfxki{xmjxhkeyn{emjfejgginnkiwhhewhzv{lylwfkkjihv{hzlwjw{vwgmemxfmwyyzvwhjkfg{ejzxligfijimnjmiv{vhkfm{{{fezzzfknjxjhxvhegwnikxwxyzhzlzw{yezzyywieeeznvfhmevjkzygxfzxlznkijvhm{lkixfimwjwwhvxlhk{whzfxnfnl{zgzfggxz{mljxmfix{ynlznylmynj{yxn{fekvnhez{yykiji{k{njmgv{ijzfveifkivkmmyylkekivhwfie{x{l{kekjvfigi{mgzmfezivkgfezyvjjv{nixnjzy{nz{kinnjkegjvxnwfgzjk{xyliifzgzy{exizgizl{vmyiewlgg{zfizw{i{ywlfehiw{nfexvynfjkjgji{yxnvy{{hmzzwnzjw{jknhhzzjz{y{yj{kzwkekgiewwzwmjvwkmiv{feggmfezwzhzlez{nmhfenh{{fgjzezjz{egmmnxyyhwnv{ggeemyjxgmzzxhvf{feiieizggheji{{ikmhxniijxz{hmgez{w{hkimjggihgmlxjzz{{jxgkzxwn{hiehxzlxwzznlzngekkzvxlyfxlzvzn{ikg{znhzwm{zwfgzyyynfhizxwyjkxlxjezmhzhievwgzznxhjkzxnjhmx{{ehkjvv{iknhhvez{mhzhv{ymfw{jxvh{y{k{jezjzvnmnyhimvwvnkiwl{yy{vwgkjmvwz{zzjifvzhkmx{wfhezliiwwimivgz{gmhvhfiynfkyjzzxlyhnhggzyegivy{zvnfwfx{jxyy{wwwynwfjgwn{fikjm{{zwxnmhixjkxym{{zyhfzzyhemlii{l{vzvgxekgzjzxfwhjkexfzyfeeiizl{e{zwnnwgixlnjxwkim{gkkekm{feg{ejxyffixwywegywxhwyxnvhxwnh{xzxyjwwwjgm{f{hhkjk{fwhylzxhg{lx{imhgfm{nwnznjxmj{y{evnxhjg{mxwvnhiznvyxlyjx{gixljinlizjkfxxyhxikmhnhiekkfxyy{jvw{xzn{jmfzwwykmgezxhzezgzvfnfyfxfjeynjvhiwy{v{lwnnyxffzxj{evhxneefvfzkgiifmzwfzeixnwhjvxfvhyfgx{weghejmylvlvwnhwykgjm{xixfikkx{njzyxjzwxfivgkvjznizx{gxyy{{zwvyvhmfnfmwvjnhnfmy{vynki{zkgznv{fmnwemjxxwgvznjgimwfix{vhzfxjeyjvhzlhz{gimkgznhxv{iikmhgzyjihmkmfmxnevwnjm{{yljefm{i{lwhwyfg{xkeylegzfwfzf{ljenhmjwnvjjxkmyjzngzixmnggvwzliky{{kzyzwzwylw{jzhmxjw{zwexikfgzfiiezwlwnfkkkkezljxzjzhhkznkgjkjmmfxljiv{jvyhjmjgz{kmjzjmzykkevzjhgzh{hnjzxgmikhegx{nzhkgxh{wznfzjkx{jexlxlhixjwnhiwnfzzvhkkigx{ejvnlyfeezhzj{gylfzywgmvnzfxfkggzgxjzegzhvfjg{ehvnhvjyfyj{xixjgkkx{hgxnnf{gigz{mwxhkkxfhe{kkifxnj{knjekxhmf{gvw{jv{xwxhwwhzyjjvxhwwxnzzggkggmggxy{{hzm{xfyh{fzlkkwwxhjg{vxjgxezgifmzjjxxywfnfgk{ezlhmem{zmhwyyw{gv{zneijzgmmfnyxyhvml{zyfeehgx{xnhgjen{wlmhhk{fggiixfgvwjmhxnhmjxxjjzevwyhgjzhgekvlhgml{nzzgzjxxwekwn{lkkxlmhixzzzh{z{gxlyj{veeyhiewwv{xjv{mjhizvhkjx{fhv{j{wjkwnyjhvxnzvekhexfkije{jxhgzzfmw{{mjegmy{vvfxhhx{imjfzkmhkxjwnwnfzgijiynzx{n{vjgeegmmjvyeezjge{wzlyjvhzw{gjxz{z{wwnnjijm{xgzjxxhizzn{jvh{gxfxhfzzygv{ynf{wyygififz{kevmlivevkghivnji{{jk{ykkwhkkgiivggwnyfgmmhxyxjxygeyjkiwljkxhexxhyfzwwwggzwmjmnkmixxjegjifvhzxjzlvlfgmh{ngigv{ljzevee{e{yyljx{iwnfmfzee{ifkmfeixhvjgmeimyjxml{gjiki{vmhwl{hxywfhmfvz{w{yjimjgw{hgml{nzzgzjxgkekwnxy{n{wy{gkzzikzzwl{{znjmgz{w{lnlnfjkmnjgjizhjznhzyywmnzj{j{ziiemzhmfzwkizl{mzhhzkkwynyfzyfyfkgnfjmhiwyhzz{wwekxlvyhx{vzwzfv{yfynwjizwngimwzvnlzfvf{ngevn{jzwwwkiw{znwfwwezvlkgmhvjikginfzlkkfmyhw{ywwwfgvwkmznxfjenygikgezegmlnfylfz{lhzkihzjifghizw{wfmwhimvyjgjezvfievjx{hfeyfxyjvjknf{k{yxf{y{kkkwjylexgvjxmfv{v{kg{ezyynwl{nfzgknh{xexhiwhixwfw{ylevigmlwygkvfxnjxyhjxxhvlfiwhm{{wyn{{jvfkgvn{vy{i{xfkfijxjzxl{jjxjv{x{jjmyyizixhmxwnygghgheyl{yexev{{xjvfxl{iyhmj{whvkmnfxw{f{f{{{i{k{xjgjgzhxhek{zx{mhjegkgzjikm{nzxxwjzgzvfimhzhvyn{yynjmgkynywjvyjxf{wgzhmnnw{nlww{xkmfkwnxn{gxnfi{ngggvemyfgxz{whwf{gjvivxnvwwjvnkiwwyygmgxjxekxnnnezzl{{zfhe{yxfzhyj{w{xmhmyz{{{{ihevwvyik{xiekiimgv{lylzwz{ywvlggeznyizv{zyfeezemy{ezvjn{emezeefmeiiefznfvnjezlhzgkfxfkgv{j{{exfkvlkmeeiizwnngezhzjjihehvnhyhv{kgfvei{lhxnfvnvljkjem{{gev{zkmfigvexyfhv{lgmievniezxnnywzzikexgihxvhwyxnml{nvjzjevfmemyhwnnynjivfv{l{fnnz{{gkiwyyl{vzzkgzz{kmwxnkkvy{gynkg{vzximfi{vixxfezixgvfmz{wjfzv{xlhiik{zgeeihvemfg{mxhkeimeemlfmvlhzvygmwhjzwl{k{zw{fzv{gvji{{iezywlkgjvw{kmki{fekfiegz{yweeiijgmjzlhxz{gzvf{vex{{ke{nnnn{{nwhnjvfekjgigezggjzzjmlggkgynevfzzjvjhk{veiwlhi{zevfmizzjxnnfvjkknfem{yyhzjvyzhexfkwwekfkgzzhvnkeekxfzlmwvnkiwn{ziemh{vix{xeizzzjxynlyhkejvnljxxfgmn{yjzjhxzyxywywnmfxnjmhgixyyzymjfgjieekgvwekjx{lyywffgyyv{{{{eegmlzzhkylwwhk{hmjyyxhfkhxx{nhvfxj{kfgwnnjkmxlfe{mmyje{nmn{gemm{zf{xkeywkk{iwfzw{mhizwfzgmfximwnegxneg{ixwzv{ejkfmeixjynvhnhmhyjezkinhvwywznznvwgmvhfmivyjevzyjifvvlggjzwfkgfv{gmyxwxynlmfwnmwvyhmvhylmnzlxhjijmgiwnzxzvxhke{fjijiwlzwhi{jvj{zzl{kexjm{ggmgegiivki{hv{{{xwzfgigkkezhvjzvzwii{gmlfz{lvwvy{wivee{fgvwlx{fzzwyfzwii{{wnmnmhvlvlheivyhzx{j{ekkjivnxnwnfmggfm{mwwvfzwywvfimvl{m{fwnjeievynhznkehk{xyfwnz{kkmf{m{k{lylzffvizggy{jxemvfzxzligheixjvzl{e{yemevhggxyfiehvgi{mnwjz{xz{kemhjvxhyyezynjk{yikhvxwkixyfmievymnhmwwywkefzyfyl{yjem{hizveveewnwjmlvwizzzzjhxnffzhxmlx{ggxhyjvnim{keekgzvgzzwyjezixnffxeggijvjvfzee{xy{jzznzjyly{iefv{mxhfxvfexfgiixjzjwyiv{w{kzj{zzv{hfzhmjx{hgxgkemfgfiixvleggg{xfgy{feiiz{whznexki{lvlyyxyww{fvniigxekfkkenwixm{zzmjjmjmexemfx{lzlzlmlek{n{kmlfz{xevzwfm{gimgi{w{mm{xfig{gvj{ygk{nxwvnhxei{{iexyfgylie{hkmjvnhwfnj{fhvhiw{izwnnnv{fmhvnl{lemiekgylheyhw{jz{leeje{vnjegnyiegkzz{egmxhznxnimeexniz{gxfmhjxyn{y{n{lxhwyxhkeynwlfexjmlexkiyj{wywjmwyyfxyzyez{xek{fjmvhnwjgx{{wyfnwfvzyhgiew{exnlzvkgezggfgz{mfvjivx{zvgzzjgkxn{e{myy{ixwii{{keev{zx{xhvhv{zwywnn{wjkwnivwwz{{iegkkiz{likwlyjyykmnwwhzyezvhxhwwkmjggvjz{fzlvwwhnwxy{jignynlgxhv{jgiv{ggezkkyj{hxyvfjxwnyh{lkk{{{zmhgkfexhnjm{zxvlnhmfyjjzmygvkeezfzzvxyfejgy{{nv{{higgiggzhjigvwjgihxiijxxj{nzwjiiix{{lyfnjwj{vzlzffvmwfiivhvjkfizyyyjzfijz{ivh{yjvyhgizl{feewl{xnhnywlgxxnzlmyzzfieg{gjgmyjg{ynjkkxhzwwnnjfxexjggkimhzyf{ixy{nzy{ivy{mixfzemjxgmgxwyylzx{hnjvlhemjxnemnfnnzyjzim{{xjzyjzeghe{ghkivhvnhwjfkx{fvgzge{nzhhkiv{v{xkigg{ffz{yfizlhkhzjvjkznmymliekiz{z{nnfmjvigjeywkgfmvjjk{j{hzzww{efgwf{ygivymfm{vhzleiezvlgvm{vj{{wyik{veiwfxlfv{fjiemjxxyzwznfknlikixw{{jnwgeem{{nwjz{m{vfmgz{g{z{nn{mwwjwlvhmhxwfmhxzv{gkgvfjzjzke{eizvwgefmvlegjim{xwfgfv{zn{znhimf{fii{jwj{w{{geizhgzx{vkg{m{hxlgxmfnlnfjk{f{vvwzhigjemyzzmnzjhinjhmgzzhezkevyzw{jxngmwjiv{lhkwlzxx{jejmzjezzvnyvfev{iezfeeekifmfmkgmnjiy{kgkgnwevgm{keexfn{yfvfyjeg{yvfjkfxvywlfvhz{hzjzhfmix{hkmzwml{fmf{y{zwyggzhmfjkzvzj{fwf{fmwznyyzwwfzwzjyygmfgnlv{vjvfzjy{{nwngkegnnznjgxynjwyhvwjwfjgvhgem{gghkfgzwywnjeefmnjw{jgjm{xgkxw{emnwykihvzj{yhvzzfzmlnwyfjkxjhzzfggfzhmwwgx{ejzzfyhkimyfzmlnn{hjk{iggyjim{kigjznh{f{xhmywmyw{hgmlhvnnhx{g{zixmfjgikhkhmyyixzxjzmyfmmhnwywgznlzyz{yf{xylvjmj{j{xmymw{fnnhmmfhkn{{zemhvkgnlfe{ihzvlikzwx{jmjzzlgveeyjnwgzgvvl{xgxv{vfx{wnwy{ez{egzfkgw{higvvlezevee{{vh{nzyxyvjw{kkjkjkwyzzvhfxyf{m{lwfnwwnhmyyw{vjjxyj{hizwjjexhkizyiz{kjkfxixzlgzkenjyljzzxikvhhiwffxfgem{knwjxfvgxfifkig{hz{ynnhkekkmnywwyemvwvlvjmjyw{kyfwhzzz{v{whnl{{em{gzvzfvnvf{{ixm{{ezjvnvnixgihevl{nhzzx{ljxigegexevjx{yylezemzhyjzhhgzfhgkezl{{vwfxxyeehinhemhg{jnweiggkm{xwngevyfmgxjkjxyyzzigyhnlwyznhxnn{kkmfz{gjkkmiew{m{{gjegxzzjgighv{yzlylkezynlynhzwjjzyfwl{yezvnznzwjex{yfhzzzy{{inffkyyv{kmv{ixivwwhvfkznfkfg{{yymfhifvfgzyjiimzn{fegzwvhgifzzlzy{yfexhwjzzmjmwizznxngmvwkixhfzvnjivyizmjeg{nz{z{kezjmnzvmnwl{mjxzwyjyfmnjxww{yjk{g{hw{jxgv{z{hjgzfvlfi{wjzkkgvn{iikeznvyiigiyfvwhz{fjk{nkkgzxy{jzlznzyjez{imnywwnlkmzlzyfiizhvmligjzfgjxiv{nnn{lfeggz{jezjeevlnnyjvlyj{{{hm{njzfyjzwjgzvzx{zmnw{fvzyzjn{vlnlemjvgg{lvlfmmffiemighxnyfvznxngxgz{jwfmjjkezmnxw{iimvyki{vgm{xzh{kjgzn{{jemwxhyjfximvfvhwn{lm{hemjek{fyjylwywnjmivnhixjmjiikizgmyh{hhxei{ymnv{nyhivwwheekgjxwyfewhzxfi{fkejehvfzjxhzjmw{yy{w{zzfhgkew{{y{xwy{mjkevwyyfivnhjzz{my{kmlmjkgeejmhivyxykg{wnyexhmvwjennfevlxlfevjjiwyhzfvnl{{hzvhemvfiz{mgkyyzwfvevgknyfeeewlfmjiyfjxem{l{lfi{zyhywmwjg{km{{v{leiyhkey{gekefvnhx{zzeiixwyjzmfjxgkyyemzwvhy{nlvhjehihxfx{vexy{hvzf{{njivnwxj{vimjgigwjfmfevwfxm{imvjhigxvlxlzzmhy{jexjmn{vyffikegg{e{jvy{gzf{ghgixznzzn{nlzlxfhx{zz{mfhgieex{lyhz{{n{{n{xfhigzyyxwzlyjywzjyhmfzlikee{hnwvyxhmyexvffegvzn{{kkwjhvkmjvjkzffv{ymlwjkemy{hx{zlhgvnheje{vhxmfvl{kimvfjmxfwnkg{myweewyfejzmjnjy{wlvwzhkmzvzwkiixfmwjexzfivvwzzvjnhzfjevyv{jgxwegxwwwzvn{ighvfk{zhzzxynzyheww{zjxjxgizwkgimzhmwggixzvimw{{xw{{mzfnnxhxykenynjhvnhmnjkgxegvnmwje{lee{nnnywgvvwie{wwh{hhmivfkznzngiyfnlzxfivnwngzmffgylfimfzxfijkyhmyizwnxlznvljexhzxfkjmxn{jzw{eivxyhxywhifkjkkkgm{myn{hmn{hmnei{igmxlfi{wwyvnw{jgx{{nnngxki{mivxhemikfgemje{fxjevwwimyyjmvyzxkkv{hgm{hx{zeggifkgigzkmxhwwvwfk{n{njmfkizjz{x{gzlvyiezwn{jenjfx{khefezjvfgejem{myzy{iwwzw{yjeyy{geexwmn{y{{ivegkgxykmwhmjvlnnhmmhezznkmfi{jy{{mwwzwixyhevxnjkvygmvjmjzxzwjehewffmhimfwhnffvjmixwwhkeevn{zvl{wvhkgzlggjxgx{fwj{wnlxjevjkgi{gixgknfwnhzmhjxkgwjw{vfieyfv{wnwhfxmlmhnjjgiijznyjkvhzfhzhvzz{evwje{lnnwlvlxw{ivjhxjkyfywzhny{mmleeekgxwnx{yn{egx{gfxxlzwww{vmfmnixjzigzfwjy{kkvnezwhyyhgylxwgzm{hiemgkzfvwn{yffevhxlkmfx{xfvx{vwfvfmxnfixnvnnlw{vngiimywkgkkyw{h{wnnhkwn{hwlmwwyzzzymjwnxlzfwwzfzljgvjwnfkzyylekyjjv{{ji{lwhxwkijgnfnj{mnywjkkegvngekkjkyyizfgwfnlzwhzvyfmwj{zzyvywf{ihvevnyjezxzjexemkgemxhylwfwhgg{jiizlvfwlvjmlxheezfnljmkigivyivixeegxjzvl{kxy{yig{xznez{hezx{wfexegz{jkxfgmyl{h{kjxwnzfxhy{ny{vhvikiznfemkggzzwvwiznwyfggzwhkzjgmmln{zngkhv{fzvhkhewhwy{nnyxffxighimn{jxhwhzjnf{{izgxywzzxny{nwz{hijxzjhvgmynjvhv{ezlxhhiwyigyhwwexhejgjmfmvykeyhke{ifgzl{fvhnlgz{vvnfgywmwkkzhzy{{{fkkylzzz{m{ekheegzzeifm{nylhvyymneenfizfkwnkkigiizfjmki{f{zexkgix{wjknwik{l{xywznxlfkzyevjvee{ykkxwvlgmfgxjznvlny{xv{evgvxlwljg{vmhiv{eevgk{xxym{jkzlfkxlvln{wwz{fzzxikyyfixhjm{lekjgzlwnmjfk{ifkzwhmwhyhm{wy{gixfvmjzlgvywmlfgx{{{fveemwwfwnezgxxlegiixn{gvjemigvygzjxgkfeigxyxhkgzxhvzhjzmynjjvgz{fnheiie{m{nxlfzkkkeikix{wke{yeziiii{g{i{{hekkmwjkiezymwfvhzz{fvvygghem{{hjmhieexfnwwwnnmlvjvlnfizhxgxvlegn{izwjfixnywexnjwl{wkmgz{yznjv{yjkxnmy{yke{hxwhknhzhjvimfzgzikhgwfywznvlvwezywimnwzffxv{feexkkywxyfknjnh{gn{few{jikm{nkmzykkgk{v{lgzfkfizwwwfmvwixfe{{emvhxhjgvyxhzlw{evwn{ghezzevgejgzxiizlezjmeifkvfizgenyzh{lmlzjmnzhz{{m{z{nkkhvw{y{nhvwexvnmlmymlynkixfzymyzfhkiimwjihmvlwhfgy{hvxliez{gmn{{v{{yygvgegvhxv{jghvexev{g{ijixljgmngzimylfgjv{njm{yfvkmie{xkenfezxfnjkgyl{fm{wyzwhezv{lnjjijzgzjevfki{jxnemjmhizxvlnhfgiehvzfkivlvfhxgzfivwvwww{vyln{zxfgjvzygigkimiiexkkikvnwh{jfvzlexjejx{w{nmwzhkeyhimgzjmxfzf{jwwvfvh{vjk{wizjmeenh{jmnmfge{jz{w{z{{yw{{yjgwngizfkezyvfgixlkg{lfxzwwleijmz{ywivik{{jvkk{xzhgmnn{g{ggm{nvfmljknfwyjenwznvynyegmjggy{feje{{ixxnjixlyhgev{zhznhm{zhvzwfxgkzzzlzznhxnjikiwjmhjz{mmlynjkkehmhxjmhzgxnjy{zy{zwwixjkzxzwwnxyyngg{wv{jx{y{h{xfxkekgw{gv{ymh{kywzy{kzyeezvmlkiyfezmj{znjikhvimzyx{evmjwhn{vhfigmfx{iwwyj{vei{ewlexx{zhvwfzmlyww{hmw{w{vyxwhmkeivfgjkhiw{w{njfgiiggfxfmx{{e{w{v{{gigk{{w{{hgxm{zh{hzjjxkmfvxnfi{xwyfzvwimvlegkmhemnfvegezkggx{{zjvfhiwymfimkiivwyfx{nzyy{mjkgwjnykgwhfevjfmyjxj{fzfxfevjkjv{igievizii{lyhfeml{wjxjgzvvfmw{lwwekgiy{jgvwx{fvvjzwwyiewjjzx{gehmzyzw{lgv{vezvlvwmfz{mjmheigzgmfvvyyh{zxjhxwlvlvwvjhvx{y{zzvfkkm{wyw{jgnjvh{efvfghg{{zlwwemkknjfxgx{fmhhz{fixkenw{v{kjznlz{znieegfggxixkghkhenykgmwfxy{jgmnzhjigzevyywlmjegzhjmjzy{fkjkegvnmnznvfnlnwfgxhjkhieiivjzxynymhw{my{mwl{nhxivkijvkiezz{exkmjinnwy{gfikkgmnwzlylexmjnhnwivv{wljkzlkgiem{{xjzjgjz{nxjgxz{izhg{nhxzfgvmhwyvnw{vy{ewyfekgegnygifkwn{iimnlvhyhyngxikhe{hekezekxh{lnnvyhgixjvjkemwh{wjgwjzhjiyyemixhmjkjg{xfe{gjxjiig{fjmggyhheynnf{wkijzivnlgknlmwkmkigvzhxnxyyyfgigjmkgimeemhxnmlvjml{nixyfmlnlge{z{higxjmwevzzmh{gnfxl{m{gnfemnl{y{gylfi{gfezhjkmj{h{vfi{fjg{hjkmngzjghkixizeinwyfighvvjhi{{hi{v{k{efkmj{xmywwyf{xfmwnyywnkmnj{ynffkw{fk{wvhw{igevwnjkfvynvlyjwlwh{{whzjhiznw{fejm{xixfmmnzhnfgkiijvm{zyexivyn{{m{ynhxfigiexnlgexfzfjkjxhi{m{gw{wnkkz{fi{nw{x{jgfehexjz{z{fmvfjxwnynznz{mnnywjxf{vynxhkimjjkhzvlywmlgmzwx{jxxnemfijinwexjefkylzlwjivix{wywgxwn{jxn{ieeizzvyhikmjzymynwjvfenwyfxfexjgjgiixyfmv{fzw{evxw{l{kexv{fgnjfmyn{zie{nigfifzfzxwwlkgmhzvfkigzxjmnfhvhmjmjgeiv{zzxy{ejg{l{ijewj{yxnggzj{ghzez{egmhzei{ievxhix{yeekg{xyn{xhkik{xvy{iwnyh{xzwgzeizh{jx{{yyyezgimwxw{kyhgm{nvwwj{nxfxhfzwjzykm{{{nvwiz{hwfnwje{wmnzhix{lhxgmvl{fvhzhzyiikky{mlyhwl{ifgjkw{ywemjvfijijiz{igikywwnkkexwymlzngmgzywvnivwwiezywngxfkgmmfigwjy{jzmjjevwhenjgvgg{jegizwjxnwwny{hkefivhgi{{njjzmhm{wnexhvzlmjekfgjimfixivxnzywlwnzyzzjmmlxfnwnyyjfzegvyxny{z{zwekeximn{{lyhylyhzhyhv{{y{lhvwnxlwlfg{wxnixegimke{yfmhznlhvemxhkijkmlwlxfge{zx{nhnhie{hmlmwjm{hhkhg{{gxjgy{mwheyjwnjm{ghzjkyhn{nfjmzynhwn{lvnhiik{wxjnhkgzhmfhvwffewwgigxnfgzekvhzvezizvygxzyixhefiiennxjmjjmjvjmgkhgwjivvwnjjexhji{figwfy{igylmheemykiwnwhzywnheikkmvniiwn{vkm{nnlhmfvkmmfegvlev{lgzfkfm{wvnfevj{whvjimlv{kg{{zznjyjvh{xfmem{f{fwyfzjg{izjkmkkmhvljznyiev{jmjkzlnwvnnyhknhnwixvyzxemevxn{vix{eezzz{hvnimjexyex{xekim{hxy{ygg{iji{vjzyy{yzz{hje{nzzhx{kvfekggywixkkm{zln{{ghkwlkgyjzxxhmfhkfkjvnnfzjgjmm{yw{m{vgvvjhxynfiiimfee{zzwzhmhfzzvwy{nzyjgemxwmy{vmhyffxei{zynjehizzhkfgml{vzyy{gixfemfe{ngkexvjnnvhgmkm{gki{w{lzv{fwlkejxvymjjxgzmnwnzzfinnylzngkyyw{xwv{znylwjki{njehefvvngekimfnjyy{y{vnf{hzxivivzfkifgkgegynvhivww{egkvyvj{hfexwnhywexeiezw{hmfzvykmkinhzymhkgyl{jfxjegxvh{eizzh{jgivyjiwnjznwfv{vfmeivfnnv{zfwhjgnyhe{zjxkiixexjvnnmnyhmw{mzyfggmik{i{hv{iifmzyfeekzyy{imvf{ymhjkvnmwnfw{mjiege{jmhylgk{{hxjxwygvgxheyjhvwj{jmlnhxwkmmwxhvngzkk{ykgiijknl{x{wemhzfezhjimfkmimynvlhgzyhkyw{nxjvlvhnheevyemgvzlvyvfzfwlhvkmfgnnwfzygkxnigek{fjgfiggzjvwfgkkfmwhexgevyjxz{jzgvmlek{{jgfg{{hkhxwhkgkm{jwlggiemh{wnn{lkkzyvfixixkmkevnjmzznfizfmjew{{n{{vwmlemizwwvjjz{jjgjkfkhz{eixy{nwiifmhmvw{kywzv{xjxikfvx{kkfxv{{ejenfjgwfzhzfhv{ejkynmhwlfgnlxfwf{xyyjxggzvmh{fekhiwn{lgkmlizmjggeggvkgemjehzzwyffejejk{fyyx{iv{fylwffezv{yjmmjnfvfee{h{wjvhgfennnljxn{fix{{jx{ixxhmhkihmzy{mhixlz{kggzmf{zywxymheg{i{njijvvf{gfknykgwl{hkmnhvjmwzhnhmlkenwmhyjz{vfnjizfenl{yzhywkmekml{fizzyhvexvlwfjxigwywfzwfz{niijkhgjzfezyjmz{gzjkixjzmnjgkkvnhzjzxfvfnlfivyjmnhyyzvwymyfzeifehvynv{ezivz{xjjzwwegfvgz{nwygzn{{nezxwkmzlwnfgfgvlnfz{zyxlheimmf{wxjkkjezxz{nyv{gxmfkkgizxkmheki{l{jvygxznmnmfivjkgkggxjjgkgv{jg{{zv{v{nynjiylkggkzfjijzxfzhyjvwnlznhg{ey{wwvyfm{{{gz{xnhivjvwvjekzjwnien{wf{ejevhxw{{fejgxlhzvhezmy{lii{wem{wfvkg{jemezmhzhgmhky{vlmyxnvymynyy{{ymhy{jgzymnvngigkjznwwwmwyfxlieyjywgvyhmjfzgx{jkgyyekez{zfxynzfxf{kkgyfmjnl{l{gvhkkyn{{yjwlyyvf{hjmzlznw{{hnlkigzfgy{wnkmimzxvhmj{{{lfikkwnnfhxhvfkkejmvnvhxjhgfkki{vwhyfgxyfhifkhgvnzyxywn{fhvikzxzwvl{hwhwnemfmwnn{zxwn{zggzvezwjgi{h{{xynnfzzlwnmygekg{h{njz{lvlikgm{jzl{wvl{jzwhxhvnfgmhznleefxxjn{zwgmy{{m{zw{{xkk{jkknlfm{lik{efmzlz{gevhy{hknhnygmfvz{zz{nx{ii{jevzwjg{jgvikvymf{vv{evxfm{ylgxyf{fm{xf{zxwwwemznfmhveiivkkjzwfiegz{jjgjx{{nlnhjz{ngizlzzeix{jzyfjxjmvnvwvl{izzwjekxyizvlev{jnnkiwj{{wlnf{hyhmfmj{xfiie{lz{vnevwyjifmvfgizwmwkikimj{xmhzzzwizyjvyxj{vx{kgzwvwzlgzimnneifv{jkgkgnyn{xwemm{{mzzmhyjimgz{fxjwljmnnnhfmjximn{ixjgjmwhmhiejxhxemnjjk{lzlwwizwnv{wwmwggzvfx{zhzkkgm{wkmzhjekggieizfnhjkfx{vje{{wwhmegwfggvn{x{nnjigheeiwlzh{h{f{vgxxw{yfg{wjxzwhgywjifzwlexx{ywn{xjzw{vhxfmyfeexn{fnhgekk{{kk{jjezv{lvjexgzjmgi{wjifm{e{gwlmwxjhghmwjiegzkmegikjvegnjixzhjzzyyfvngxkikizyggnjzw{w{xn{{nvfezeihmnnieivwwjkvljxhgighghvgizjmyjz{mzvxlnj{gfkjxznjikk{ygk{ghiwwgg{nkivjeinhimfk{y{hmyxnnw{xmjyjemezjmgvje{wkinhnjwh{vvhizhezw{wmhfi{izjz{jgzygzfinyzfzjvywjzvkmizkmiv{hxn{{iizfzvhkexjgvygiwnzwikwlmhgv{fmf{vxljiwwgzvjzvggjzwwxhkeynfvnliv{nywzhie{vfkxlnhixvlylzwgxmjzfizzj{iynigxjfzeezxizhxzjikv{{iylw{jziexjhzwfnf{vnyjiy{nn{yxhgekgvn{ihimfixhxwfvhkmxj{vjm{{zwwhzy{g{iwhzxywjinn{g{ghmhzkgmwjg{j{zyhwy{zzlkiyjyyjk{efzwhzwzhzliefifi{x{lwwemmlfggvzxnnwf{xxy{inww{{vgifmigegkiwlivfvvjfzv{zhhew{vym{hk{igijg{nfimwwy{eggylwjxlzyzzkg{ygxjiwlheyhmynh{{eejige{ixfvnwjekvynlkmxjhx{nxjexnyxhgmfxzyhenwfgez{hzjxjn{wlkm{ihkvnmwvyy{gxekyym{nwxyeiwnznggmfwwzvwn{zfkeefkyj{kylvheifk{zyhke{mml{ifg{gikivhgmjwy{y{lmy{hnhik{nm{iihmjmyljx{vvjzj{lfmyj{gjx{m{eiz{ekg{xyfikvwkehvhzxhfgzzjvjxixnhzf{nmf{lgieijvjxzjeifg{vfxxymh{lnwkkezn{zhvhjihiyngmem{wjgegzxznzywy{yyljiegzhkijxkeimhm{lnwfmnwfzwhegvlwfegvnnnzfiigk{wexzxvlv{fk{wwlzykihvz{{wfifmkgvnfgz{hzeimwikmlznx{jxyhywfenfixfijmywwn{xegkiw{mfeiwfmjy{ynnyeehvw{hkxhkgmnfkwhz{nhxwfmnfjvxjekvwgzv{jmywzlwlwf{ggizlyfgmfkxh{iv{gexlxfmjmf{vxyhzginhjenfzxgkhmgzzxy{fvnwfikejgjzjmyw{jvlfv{mv{hi{hizezimnwjxmjvyxfjz{nikeihgjmywwwwhjxhxgi{fikylfgzhvyzyzzkgyjmfnyywfkhezwemw{jvjemwwlzhmyz{fkjmgz{gwhmj{vznfznjjzmym{{n{gighvixizgxxneeke{wxnfkixgeexexevxyvjeizhmhhxizxlggzf{vnhiefefkevmlfmiiyf{mfgy{nfzngvfevnvlgkiekexfzyw{nnezznwjkgvnzlzyhz{eggke{{{yynkkjezxix{mii{iezgvzhywmh{{ee{vizkimwylhin{jzhmwhyhgxvlnykmjzgijv{zmfjmjmegfkhkyhyw{vnnigvlik{yyhji{v{jnfxlnyzzwl{xhkxlfx{ekghvy{{yn{keixjinw{ezfzvn{{wgiivxjhk{nv{myv{fzemgxw{nwfzgiizixke{xmjegheylemvnimx{xnezfkmwwjimzvyynfxwgkzxeggkivhgwy{ifkkizljv{mhxmjmjkewhz{jgzwwwxjn{m{{exlvh{{xwnj{gzljkemzw{xiezymlnyjezjyhzjznm{{jxfv{{hezyyhgz{zvigyjvngkgkkeeziezvywjmnhnffkhkfkfimhggmwfvfixlhikgnhfevlzlfehz{mhxzwhxjxwn{ieggexnvnzz{f{nhmgxhzein{hkznekfzgegk{nkiegmnjm{f{jjg{gzjixwliezjzwyjhvzj{lggfinyzfjkjvjiyl{whggzjenlfgzyzjz{zwemwjnjgmgievmjeefxmlv{egnykkznhgfmje{gnfw{znhvee{k{j{h{vwyznhzhgjmxjwwwnmfik{fvnhiwjixzwnwnf{gevkgnhfzxf{ew{xwyffmx{ekxhyyhkyjmffexnjmxlw{fk{hwnnyxlkeylxjhkzfekken{kewhjg{kvfeixfjmzjeg{knfjigv{g{x{wznnhkkn{{yjijgmnfehvfkhzmwixfghefk{in{{wkeml{v{vhvgkywjknwnfmlggwfgkki{fnnxjwjmhywnjwweeylvlmy{yfzezvhevhznnxlivjgm{{wwnmfgkegjky{{x{yhm{fylxlkknhhefi{wzhvl{nki{weez{fmzjmj{y{knlfzn{jvzwgxgznlvhxjjgfmkgvj{hv{w{zxhkgzyjznxj{mgigvxleigxxh{hwwgxekxljxnhywjkzjmyxngxw{ekem{zwnznyy{{njhmki{lvhv{xlxyz{{e{yge{l{liziihvkgvfvn{w{hnhhe{l{hgvwj{{vjz{ywevwj{iylmj{gzxjgw{jxnhzzvfjixwgkek{evffe{wzljzzjgv{jgevl{gjmgimjgzv{nfjkjxhkezhinfjgzykkwhhmzw{z{hhvhz{{hmjgxl{mzhzwgeevnyfzjmjvgx{ihvfiikwn{lezhgywhkxjxhwywhnhfzx{zxiifiznv{gmgmwjfxizgiji{wyjeg{njvwh{nhvfkzx{jhifkzxjxkkx{xwzlxn{gzlwnnljzznezmh{wkifgkenw{kekxjeefmfiywvwjixhkizvgewhxhwwkgvfgmz{imixxyxjfzznyykihmgk{vzvjimyzwwwgxfeevjmkmywyjkkgijzxjzhzlemvwvfnwnh{{fizfgknhggzfn{xyz{xjgigkee{lvhnw{xjikiwfnwjxzz{vxnnhfihmw{w{{gmnvnx{mwhxyhyfzymfvlhgw{ywwy{hikfizvvyjx{yznmlfiwwgvjgmyjmyljmevmyemzfjinlmnhkfijeivnhei{e{vnwjkgehiznigvljiezmngexyvykgvlfehzfvjm{vzl{wzlmhzzzy{hhk{gwlgmwnw{wfwwzyfzjzkemnjxvyekml{kfiylemfevhzygiw{whfmvhfvjxfe{yz{mlxlvyheyjn{zlhg{hekxhvyznxf{wkgmyjm{iwhnjfmvj{ykevfwf{k{gekzlwh{efmhxz{mjzjegmjwwfieijzikz{gegkxlgigzeghkjkyjznzzznvliijzkmxjzy{mjiz{nygv{vgkixkg{ngiyhw{{fmhm{z{zjzl{hkenwvyyfvwyjiiyymjjkwjfveikefgigzxjiywfznjfkxyn{y{wnwlvfgzm{{lyfnjxy{x{njkgmzwmhmjnwjzxhjk{nhiemzhhejzgmhvmymfnwmwnl{lzy{khzjkmnjmzjjk{ijxem{jgimwjk{wmf{kjizl{jkikekixjmnvfz{hgkk{xhegkhegx{lfxhk{{{hxjyjfihvylhgeewwiifm{fwjvhgmwwfzggfgwy{nwj{nhejziemyjgvygixwnwgk{zjgmlx{gvvww{{gzlv{n{iifzigiigxkiv{fkmy{xwjxw{z{fwlimvn{iexxjjghzxliigiememjvjghgkggexjje{mwyhxhmfmegexhe{ffxzxgxevml{zivgiywkijg{wjmzfml{{{z{zmhfmzzvwm{zv{weg{lmjgez{{xjkhvfx{lwfgzzwylmjevmhjxfxn{igmhjifzzxhgyweehxzjevhkw{zx{myfgmxn{eizvywy{ehg{gxf{jzfvjjehimj{lhx{xfmjvz{eg{myf{kwwzy{gznkixwzhggxliv{znh{kgejxjgixekmhw{{iki{lv{{wzlmjwjhvz{jxhgzzvhezgghzeim{njfzgzggmlivhkhen{fghe{nvfhiigw{mynlik{iwygevf{kggfv{jvlyf{xegxjyn{gmw{i{yjkyljxevmnjegx{iizizieyhyfjejgzhjxfmny{yzfnjix{kjeemyljexjke{fgxmjzf{vv{wwyleihkzfjifzexegx{gz{ynlz{{{wwnfimwjhkjmekiizynnm{ji{xfmnh{ifxwwvfegkm{z{jm{{vekjgzlhkhihkv{ezgkkeiiw{y{jz{gixfvz{v{hmeghkxffzzxylmnmwwfgiemkmmliexnzngmxn{xnnjmvyzwwygifekevhfijehimjx{xfn{jkzngvmhzxgx{xzwnnevjgwwix{jizyhzhnh{gn{ix{gnhimki{gzjiim{xjjikgvjekwjhvz{hkgx{nzfmhegm{egikxjjixjwn{efifkxwienyxy{vznxygmzxjezxy{mhvjgxyjz{kmzy{n{nhvnhvjxnnlfvzh{xzfwwm{jmyywl{f{wz{ynxfgvmhkiyhfxkmvwmy{yxhyl{{z{ynznkmzligiexwzwjizzyygivngzzxnnwhkizjzliieewwynzjmffiyjjvevjk{jekzyemzhhenn{zyfhkgiikgizvnwzligzwwl{jnwfmgi{lxfznnhx{znxyfzhkwfnnxjgikgjgkemlmnyf{wz{iey{jikenlzyzwhmzhjzhinfke{gzzwyfmkgnfhvizhz{enwv{zjxw{xhimj{yznwjixhk{gfm{eyfzvzzjknlhkjimnixjv{g{ngeiijkwnxnek{jnnkevfmhnhegznvwjieveevjhzxnzleefmvlvfiivynnn{hvyhggegzwezhexfzfgzmyiefzeevfkgfxzlkkgm{{hvzvzlfzhg{jwnjmgkwwx{{j{w{nzwx{ieixgmkmjejzfxyykkezgxekzx{{fvzlfi{jnfivfm{mhmjk{jimzfywevjiixw{nwfekkxniejiz{fgzlvwvnzhyh{y{zynylhewfhk{{{ygimnxjwf{hmffm{lhmwwjemwkmjivlnln{zxnfzfwfzjemhvzj{jxfzhgz{fx{zlmnywxhev{fnwjg{{eizvemvyvwnnyfjmyjwyjzjzwyywylmwmjeikejxxhzhkkjxynzvgkixwngekmieek{whmwjhejgyfvlnhmnkimn{i{z{jgz{{jznhhxzfjmzz{jwfjmzxxfzjjzzyhvgeixjifg{hml{xjxhz{exykevhgvy{hifknyxffkivhvzhjzyngemnemxy{fevemgzhiznfkkmmjvlzyyjeghe{zgejzvymjfvgeie{e{{myhekgkmjz{zfzixyy{mvwkmixhxnwnwjzkejknlgmyjywexevxnfmz{evvhzwv{jkjzjxxfnffg{hgmkeggimhgkigvjkgifxnfnhfgzxw{yhzn{iyh{hikfe{kmhjxhi{gwfmf{{vnexgmigyjkkylgkzhjxemmn{h{zmhjgjgnlnhgmnyhmyngkyygkjx{hekyw{efzxfzx{h{zizfxfzfev{{gm{zfjz{eezvjkknww{nh{xfefmfgfmjvmfzlvl{j{mvw{{n{{gikiezxix{vgxnl{yhkmlzf{g{v{givzjhm{likylzhezzwjknlm{nyfmwyywfeyl{hx{emgzzzfvnhfmhkjgfkzvxnzwmhvyfiimwlwj{zfewjwjhvezw{gejz{nwfkkizwlgmxlmnxf{egzizfe{hzxz{mhfzmwezmwhgiijkhmynnfwwyjwnz{nhikfmjkjmzfizeiivek{xm{izmhzfjgkgkkkeiefmywnfwwhgigvlfevjgezly{{kjkfxzzwwjkkewwxyiz{fy{wln{ywjkixjgwhzwzfemmj{zjejinfgz{vnjm{m{jvzvyfyfxwxynjvwggzhgxvliehekifmvhiinhvl{mhzvw{m{ehg{vnwvjgemwkeezyfx{gzxhwjzhgvnfexim{z{{gxjghzyljvhzw{ixkmnjkm{geghm{wxjeewjxnvj{jfm{imy{mzvegkmywnygmjihgei{lhmwhikzwkejvimexnymnkmmnhmeijmfi{vhvxngkhzzwhxfeynzjgkvykenhnniigigvvfywnnzynhvlfviizfgx{yji{ggmivxw{w{ejm{wjxnlznmjzwznzjn{fvm{gi{{fezh{yywhx{wmnzvfxjk{fgvyliznlnykgnyvnzwgvwfvwfzvykkvnev{higzxwhexwhfegkkihmxjgxegxhxl{fhvfenyezvnmniijvfe{yke{ywhxhkkmynyizvl{xkkzxfx{m{xjemjginhem{khejznlvfn{xyixmjiv{w{e{hnnyyhximxwizylyn{xkkwnekkemfzw{xxymhwyzlzl{vyhigxjznyyezizwh{wzfkkemzn{gxlhzxfxy{wie{xvn{mznznwfx{znfgkihxkmkihzgiiex{{iizyhw{je{hyyzwjg{wwlhkyfyhhimhhxgmezhznyizfzxfkeyfigzjzyhejewj{wiimy{yhv{vnjjzivvhvlhvwjzwkkhx{jiefvgi{emlhvxlfimfjgjgfikeezzxfekmxhjkzjvhkmxfn{gxmwfkzwjkzv{vkmjkeizwww{kfijihvwygzkgnhzf{fjvjxeifi{fxj{j{lmh{ehzfkgveigeyhmn{evl{innmwzzggjxzfzljm{ivlyyfegg{{njxyhz{y{knwjxzhexnwyh{xnwgmyfgkikizxnhgimmwfijxnljzimnwxnginhzl{fimm{fexw{xxy{eyyjihzywvymlimkkimzzem{ihvhziefgemvwvlhizngevfyhnwww{wiefkwl{vexjzvn{{eevyxf{ifky{zxjgjmkmhzge{lgiylvjhg{lfmjivjyffigzm{y{nnjkzzgkjgn{{ggv{wywiiggw{vhgzxfee{njgfkvfyligezixkkfgfmz{wy{nkgzhjkkkjggewlggm{keyjfiemhxhxv{n{fvgzgmfg{ygg{y{nhexfjz{nzjwlmfxlnyfevhylnhzwvfhxynyjzngmev{ezjexhemjegjzzhjvfeexhewnwfizgmimnjvyyfivmhnf{lyyix{lfz{hjehzwyje{ewfixeimjzngexnm{vnmlvwizvj{hmlixvwv{iejkvfnwexzzgm{khk{f{vxnnyxfgvggkenh{ggzfkvjhknhhgimnyxwezekzxvh{{zjwynygxizyngmiizlggyw{gezz{nl{khvmf{gzyginwfmjxvl{zm{ml{gywkm{ximke{xjvxljgheim{wwjm{jixhzyexhmz{zzemjvxhiveiim{knfxnjeyfjiyfwyimx{ggxnfkxfgkhxnjhznjvykkywzhxjzyvnnnxlnlznvhfmwlvlhz{gge{wnhivvl{ijemnwf{mii{xxhgmwwegnf{{jmzy{lkezjmfkenlvfy{{k{jge{{kg{{vwimzjnjmjv{fzevgkiikmynfxxwmyylxjkk{xkkemjkxffiixww{zzlxfjz{mmjjxjizh{wjz{fgmmheenl{yznggvwnyfmemvwxjfkwl{{gixyiifghivjgkvn{kxnjz{vgxzvxffizfylzwmjfgvnfmgvfeeexyjg{ejkn{y{fejgz{wykkwnvlfifzzxxwvfzhmynjyyemyjnn{kzvkm{w{e{x{yjvxwjkzleexwekywhmwlxn{xxjjknljm{i{m{mfiexjmzlgvwnhgjxnf{lvn{xmhzv{{yynwjmxj{z{hyfemjmv{zwizwnylfzw{vnwwjxyw{lvlzy{{{{hv{h{hz{gkzzizfxxhfvxl{xmjjeyfhgmljg{wimfvgxgejgylnwkim{kkfmznwjxhy{zhvjjm{xhmywggxhv{znez{vheggwnwhhi{whkvlfvfmzxjmieezmj{zvl{jgknlzlwfv{njkmywjkixnfjvgz{hem{ywn{znjevnl{i{z{lfiez{{nyylnjzz{yfiggmnxhgxemigwfgkwhim{gy{je{vyymymhfinfnnwhwlzyfknjyhmfnfyyjeeikkmjvhiknjwn{zivvhwh{yizvnzhkefeigjgm{zvnfzwvwmj{lwj{hwhkijznhxlzn{fzjyfwn{hyjxnn{xheznynfhkyjw{xf{yyhvjhk{hmhnlfmhiyyixfxylxnkeivwnmh{himxl{innjz{fexyjnynfmn{wvlkeivvw{ljvkmjxgmvfxjvygmzykemnxn{wkkizmwhzevjzmhivfmkgkiivemhxee{m{knfeg{wigylvl{jzn{w{mw{ezhi{lv{jevwjznhzywhgmwykegzwljxgvjkjzfkyjgmevx{{lxffegmie{vieizeiexfxgixl{y{en{zyz{jgvhgzzxmhzzjkje{nighkhx{vvwhekmy{xlxwjmvngiw{vjzl{xgzxlmfwyx{mhxn{himynwljijihgjz{lhz{ezjggkgekje{lny{gemfkyl{{xfvhzzzhhzwhevyh{mgzeehefxjieiev{kggm{zwwngzzwv{zz{j{nhmxjxnevkmvwjevnmnhzhzvjwnig{nnwhgmjm{{hnlggnlzhevzfvlkgv{{vgmmfxwynjmwyjiieiexny{whvfgvwjwhfgjgnnwwfxfxgmzyjennyfjmfmxjizkkx{jghgw{myywxhfzwyxfgz{nn{xjz{zxiz{kwfgz{gkevfjk{n{vjeikynkgxlfijgnlzfivgg{v{wyjvnginjfiixylgkmwzvik{hfmfew{vlxlfmznkkiezjfmwhiegx{f{g{ikmgiikhe{zy{z{vwixek{xigeewnfgzwfmx{ggy{iegm{ny{gk{xfmnjzhkmzf{xzww{{h{hy{ggemxfgmmhimyhfihzzlnwzyiviziiwhfm{jfiz{zv{f{hegnlvhfkn{{jfkgzkekewl{v{hhkvjzhxw{l{hjg{yxfzxvwhi{my{emn{whn{{mzhhgjekmwhwf{hmn{vny{lfggkgky{nfnlheigezwn{exn{ewnfzzx{fmlex{mimhifgivy{vfvjfzfmmjvhvn{j{f{jfkjkhg{fml{imnzxylnhivxnji{iwwzyexvhigzynhzyjvivzlvfwymwnyjmfvjv{ngzyyz{izxfkkwlnw{wgikkgegxzlvfkifzzlgk{mfzfxegww{wjg{vwwz{nygiixxhim{zkkkewnnfiiii{iixivvhn{xfkkegwn{zkizveejmnlyjmnhewfywv{ynywxhn{vh{fiikgexxlxlz{hgemfvx{x{wnwjwj{higivzw{vnnzjwnkkvffkx{ywnnyf{jwjhinwwfgimnx{{xikjvzz{zmygx{mvnjxfg{k{{zxy{zljzzlmnkgywv{eijzhikk{eixjgvjhev{{nwfmleehvjmhgx{xhevfex{yjvffgxlz{zliikgyjfewhxfw{wwkkhi{m{exlkgwnwlzx{y{wyjgiv{n{{f{fz{{gnnwhmh{heefgizhzjkfkmn{v{vy{fgzy{{gexhnyzj{iz{ki{w{yzlivwj{iynm{{kjekimlhgkgfmny{iexexjggz{wigzyfmfvgvnhzhkkzvhxgx{infgixlwnhkixhegxzv{{{exlhxjzhk{nw{vyjmgxkiwfek{fezixzjnn{j{kwnwwfgmymyzheeeeiv{{zfw{nfzzikim{ey{hmzx{lynyfzwvhnlhky{zvzymw{vhgvyigwn{{{xgkekwnxy{yjkyyhm{x{yxyfi{nxwzzegeijieezn{jgmyhhxmj{kfknl{g{{zj{jfixnekkiw{xnzlzljekmyjiiy{zwnnhe{i{ynh{vjggkzxhi{xikmljvjxgg{wwjimhimn{wggzj{hyyyyxlfenlzymngmy{vynn{fixw{zjgkfvekxjyfzjixnhgxyfkkxnynfemyzjkkjgixvyyfhenh{xmwwfvywlxlxlkmm{m{gmhzhey{eegvjkezvw{kkiex{{yjeeznyfggvyvnmlvlznynzvvnjgwyhkvheznfivzzizx{gi{lhkhezf{vwlzhemggy{egwhhmn{nnezemiijveizzkgyfgkkexjhzhkyyjxzfzfxwwwy{{y{lyjikzwwhynzw{wkeevfmemnyyneeemv{z{yfemzlznezggeiz{gxgigxkk{fhgekfvyfjkhe{vnwmn{h{ggzjvhzhxemnljxnlzfjxkim{wjgzgxnwfghxzfmnwjii{fzfvhvfmh{lkeighg{gienleg{lzhexgvivwwny{y{f{ejgfin{evjgiemhfgxnmyjikmgewhggzwkkfvevwymlhm{gzhfxnlw{xhzj{gfz{mfzimw{emgi{yzfwl{w{v{xyl{xix{kkeekkkiv{f{lznfi{zgiv{kkhzfxzjvwekkkvn{nw{v{znznzjfewy{whvwyhxhkfexhzwml{yzwnf{in{{{jkginfkgyfhmgzjezhmhzjemnyzfeeivnjn{gmznjm{wgzv{jiixy{jey{ylkgfxz{w{{inhzvem{vz{hg{zhvkemnyhww{hkenyhmmwjvyhvnvy{zgizfx{yjgeigjvjmwhgvwjev{zxw{vjkhe{zmjgznlzvnfhvjknf{jixywjinnzfzyhm{jzxmwgxjzgeyl{y{{fkemz{ex{wgmfzwj{wjezlz{immlvlekzjnj{wjxwfmheigmgiyfvnnjhmjige{in{egkev{y{znivimkgwngg{{vwjkvw{hezhehggi{ewyyfyhmywfev{xmjexnlizjeevnjnlylnhjxez{vnyzwywjvfkhvmnxyjkxjgxfvfekgzjxyz{fmwnmnznevkgwffevlizizjkhvy{jznhmwgmylezgvwlmhivmnjxgg{hnhggmy{{kgggnn{vnhexmfggwjvhfknlwhhvem{lfe{myjwnxwjgkikezy{fimgemfn{kmy{x{{wik{hegjxfzekxynjjznh{gmlix{e{nwyvh{znhfvnjzlikkghexw{x{y{ymnhvhz{hnyhknfeejvywny{hjkkinjwn{zxhwlnf{k{z{hznmhfkjmfehzkezzki{nxjekhivlmjxjhijvzwxnyneeznevgv{ffvv{kivh{e{yfivwgefzkefkeehzfmnljkn{{wzhkkeg{fvnjmzx{l{wvlxjjvkihmkgzhixjxjzgmjgynezz{jiimjm{miznneeixfzee{ennhin{vy{x{nxlww{wyhhzww{nz{{emfgi{jegv{yfynhzgeyjxlixw{znvfevhz{wgmimki{zfziewygvezz{xjgzwyxyex{fixvynljikenyvfm{vhnlji{feizxmhwwfkmf{jvn{zjz{yhgnwmw{hgzmjyfvfxwfgjihz{ejeezekkeiiemnl{hiifmwny{vnhv{xhezj{mv{he{jnywhmf{inhvlwfkmgvwwhxmfzvzjmwvhemhmxynh{{kijgjx{gyn{fmnm{{g{jgzvymnev{ggeexkm{{njvn{nmleigvjmfiezgvvf{gmlvwvheknf{fylkifzzxzlm{hgxhzvyjeeeeizzl{{zfwnivv{fxev{kzwfxkkgk{kkikmzlyh{lxlwfignhxjiemwkmjkzh{enlhemw{hvlge{wieywkekehzjxxlfikm{gevwhv{nh{{iv{fkkhxeezjgmvn{h{xzyynvyei{vhzeezwhxignyezjzivzlmwex{lhvjifkjxjiv{{zn{{egvkehimlm{ivwygzv{yjwnnjjzmyemywxhnjezvhjz{ngz{wvhxyhmiev{{lie{ezlvnx{{yv{em{xzn{xhe{jzj{kjkgmhkylgmnfzfvlwjy{gekmigheekzn{ymy{ejmnyvn{eyhz{nywlmlm{mymfyywjgvhk{m{ekkzhggeky{iknwzhhzxhgznyfzfkeex{ywm{izggxhxnnfimyngijgvfwfyjie{negn{wy{hjvfgeihxvnzvgg{evygxz{izzwzfhi{kzy{xfvyfhvfkyy{xmwvjnywlnw{gjxigvfjzynzljem{yhez{heg{kjvmljz{xm{hm{e{jgeigekjgvliezzemwwjez{nw{wvyjmwh{fxj{xyljmy{v{jmkkjkimywiv{xzhjgw{{hgikekm{iiiik{ifgwwvhgzjgzw{jvhfikikkjgixkg{zwjfefijkzhiejk{wvhev{knlfxyyzzhezymwwnjg{x{lhxwjnyzngmzhy{emezjiv{hzvfgmeiyl{{v{ivikgiheyhkkhmmhznkghxnwnnmfxlvyzyzznhnyfvei{vfvhknwzh{{{jfgegznm{ji{iivmlex{ggvfmywzlxffxxnik{w{lvfmlvjynkgyfy{wnigyhvfwfvjv{{xwyy{kigvmnmfvjjzjvzhfx{wgmfxvhfvvjhim{fezwekheynww{w{nylvl{fivhgjky{fgjkjiwnyj{zy{gzfgkezjvngizfemvwzjgxkixyhe{yikvwfzw{jeee{hixxyvjvnggyw{fzygkkivygmxjhkwwkmzzvfvhekw{vyyhwn{mz{{vhvjigiyy{g{zmhfegznhzyivkmvjje{wnhfzgzwngifem{emywzzjxvnkezhwhxyjxgxxfmyvwhz{ljgyf{zkgkefmieyyzvemxynjw{{yem{yiizzywjgynvjgx{fhizlexkexwivhe{fhkyl{mjzww{hylfxyfgeynzyjzkizvmnmyynzfhvhkkgvwnlzwynvjxnznjiv{ivvfv{{g{emlhvhzzxmfeeizegyl{wgzxlezjvfmginlmhjejzylnhigvlfggmigevxfzwjxmyvlfi{jevyjggvl{{hzjxkkggn{izxlyyzzfxywvwfejmezzjnhm{{v{ewhjmfezwzjig{gm{{jgejixhxjeiyjhxxhzzxw{hmjyf{vmhxyxjxywfnykihmzngzyngexwjkwwvwkeexgiynexgvmy{yfknhwhxjezfgn{kgvfnljk{zwfnlvjjeyjighxnjfmznvy{mvjvhhkfgzjjxwy{mkem{eehxhzhk{zgmkezyzwezgevyeghgee{fmfzjjexljxvyxnwyge{zyhjgyl{igmmjemkmwhwnnlieeg{xhxjxwnyfevgxx{{iyfvnkieijkyynnzx{x{hzvnyzw{yxhnhhzgx{ykkkeemyfhveghi{ivfxfhmnw{{fgxfwjyyv{jxevmlxl{vji{{fkjmwjywmljg{kigmhvlgxyjfe{{znkkw{gifkvfxj{xkm{y{k{giem{yyvfnf{kjgemjgvjvlm{{veiwn{fmyjmjgkkhgvfm{zykeekvfvlzfgvvwikkkimkin{jeyjeehz{y{h{mxngvzlz{xwgiznjg{wfkzyvfw{vynnheylkkkkxy{yxjxhgknjgm{jnfjiginnwjkiixzfhzfinfvhwlfigmnh{ffgywwwzxgmwh{zzyhkkghez{{kzjjkxyy{wwwhfm{fxjn{nhjxylvfvynjvfezm{hvwynywhiv{f{izfnfimjkevvwmnnjmlmljxfijeywzwkk{w{lekwwjzywzjnnhxvn{xny{mnym{vlzx{xzz{hfzgi{{eivyhv{m{{{whvnnyhkezzvfxhzhyyfmgg{l{zkgvfvnggwwienjmjegvf{gvh{lkkfz{n{wwffvvyw{jifgezwfyhjzn{mymfvhmhfinh{vimxhfxkiggwwnfkiemzzzxjgivizegxyvhz{xwgkieyyggznjkfxyjnw{jfmvfx{vjzwevevynznvwgzx{wyzjmlevnf{g{vfezfxfivgvgx{leg{wvjjmkeix{lfggkwwywhzwnmhiznlwy{jzzjihvnlvwgzfgmhkmmf{gvl{nzhgen{zwik{inygemw{yjzy{yngkylm{xhhiignj{infhzvnzhfefeywgkge{z{jgevw{vhvkg{ezvvhig{mgxevhkjv{xvnmn{jkewfeghxzwxlgzwfmlyhjxhv{leigix{vhzhje{mvnvwfkjzwjhv{wx{{hm{{lvlggn{{{vhnjznznikgmjiekfvnnwwjxm{vyemwwmjeijixf{evljgevwl{{w{{yfvz{{xm{fg{hm{n{keemke{jexnwvl{{jgnfxhxjexgzixxffkgizyjgzlyh{lkmfz{gjv{ljeiimhjxfx{wwyhgkivyxnvfevgifmfknnmhekhvvljevfjikejmxhwwwhfm{nznwhxheg{e{hhzvhzxexji{jkgemmfv{n{z{jxjvkejizlhmvhmh{jfzjkhkvjnjwl{jwffz{m{ffkkmxwkgv{ev{lyyhkizxwixkevlnhzxzvmhixwnievnexyjn{ivfmji{wvjixfegkmf{xwffxgv{in{ki{fkkkenwfmgzvwikjm{hki{ykmxnzwwynnylhkkekk{{mhizm{wfjey{wnmwkizzhmxjgxfxzvzzekz{fiyhiez{nyjmfgmlfenjmhzffiznyfw{zzz{{h{yvlznfgexwjjijkkgjxzwmlekww{kkm{{zzzvyjmjwfiijmnfkkfzhziew{mfgzhz{h{zwlfi{lgxmw{jwjmnvj{{fegkxhyjwhkmw{eg{yevfvyhke{jjkwhixmj{{z{vlmn{ewymh{ymjv{zxmj{izzwnyfzfwhwf{lvygxkgfgnnwjynzlmwjg{{jekifmyfiv{fgkmywlgiyngxvlhkyjvlfkvyegkenyxfjxzhwjevvhywzljmixzlgvnfzfzhy{{zyjfimlnnv{iiim{efmzlznezmhfvzjiixjgefvzxxwgvzyxwwfmnzv{zxykknnxwgenjzlfzgxmymnyw{zeivn{{whnnjmxf{fw{wfevx{fejmkg{kxyfxeiimmhzjeeekkejmegwnjenyvl{vfgfejkznxhxhhgnhmhyljx{{yjvfmjezzwz{m{xlfkwffzgxfg{{fgy{kgxwhggzzyekzffizwzwgin{iiimzygknj{zjgnwegekfehx{wgzvffvegv{yly{giylwyzhvy{ezfjzvlwfzyhzmyxwyfzznhggnfkegmv{{nnjwhnwkmyjge{vfvkmzhxwmw{{femlnjzwfgjggem{{y{wjiiemlyj{zxj{yivzjeizyywzv{f{whx{xyjimxfezyn{wvyigyfzy{fmwkgvhnhyw{hevwfvwxjegzyywik{{ikwnvjgem{vlivxjzngevl{izwgiixjvvnwjhmge{kwwimnfz{m{{vz{xwhzvhjijzxjv{xngiekvh{i{wzlfkegiev{x{gz{ehxzwexezjgizn{zwgiwfnyzwzhynjimyv{hkwn{wyhnynj{xzfivfvgikgvnw{ik{{zygejmmlzjx{mj{mzlfm{nwh{v{hxhfi{khe{zkmhzizgxz{zj{kix{f{nkkmjjznlm{{g{nzwywzl{ievfzigevy{wwzyhkein{{fzlvwjmikgzzfznzxzxfg{mzwvygiwlzxzhzlwwnjmf{hhkhgkeyyixgennnwzvnhjxmn{fjkexzv{xfkxlyhwwz{vyhzexigjekg{gezzynljvxyhemnfixwkihzikhvwyzhvhjimjmfimmngzhggikgvnywnlhejixlvffzfzx{vhgkxjmyevjgmhnjfkjehzkkfv{hevxhkizxyhjxhxyh{{{h{zfgy{{imwfg{mfkxhzhimw{vwyyfvemfvmn{n{wmlyfnnegzfwwhvzzzwvlikwwjezzwwfivnx{mwevvww{eiwlzfxfn{gzzyxfjev{km{jjk{yfkvlv{eegkgz{{ieyfhkjggxvhkikizyvhgmkeikmlyf{kz{zlji{ymwnlemnwnh{{zwvl{yeixhfmkmkgmln{nnxnyl{zvlfehvjzhe{xexwnzxxl{y{{vwnnv{jgw{exyywfyl{nkkgzzv{wkggifiwwnyemnlwnxyjvnjzwix{{hvnnnjmnge{{kejxxhimfzwh{jzxyngmhvzvjzvfvyvnhvyfnjexie{{vyvh{jem{hiezjwngvwhjmyfvhvfywjixhhxiiwyvw{gxwjzixgxeg{e{mxnix{z{jfeyl{hjzxn{nnjznnyn{mfwy{e{vm{vhzvv{hzjzzhjgzyexwfnnfv{mx{eg{jvf{zeizwggegxhxywnekekvjvhxnnlzxjev{km{vegvjvnvnyyzfjekmwjexkiznznvhxnnhfejknhw{{mjmxwfe{gjzfiivhiwyfgvnkmzym{iezlfijvnwizkkhezfwh{iy{km{zjifmyfwnv{jzeimfwnnfwn{x{yjmv{{feznnylyh{{yjfkvw{gzngizywl{vzwzv{h{j{jkewjxfixyw{ifkvjkgnjnnw{znev{nnwjgywyh{leewnhm{y{ljvyyxj{{vlyfm{zlzjnf{wzvzfigwyfk{hjxxjv{ezxwyweg{xylylvhzlxjjgkgzngz{jnyvfjkwwjezngkzhznvhheimgznj{k{gnlgm{g{ynfggy{iijgmlxwzw{nnf{{eiznhmem{jwy{zfvzzjxvlgkzh{vjixn{{je{ffifgny{lfg{ky{ezyhiikizf{zx{mhvlfmkewf{iw{vfvfgmgg{yvhvhwfmlwy{{hgvhezv{fvz{z{nh{lwj{ihzmnfxmlkm{e{nn{wlvwezemxjyh{xjmjefzvhgxkg{{fmigv{{lvwz{yjznggy{{ykijxfe{yvwnjwjjgzfegvhxjjxzleivjfmgx{i{efgzxw{ixhe{nmwzjmy{nhgiimyzh{zmhw{evhzgejm{ffkvn{zkmxyxjegwjz{gkmnwligzlyyemhkjxkewynjzhhzexwjmh{fxyjxvhyjnfjivhxymhnfyyjkjv{ngmggnhgkwjwnxykkv{ki{hv{ixyl{vjehe{eimzlzxfzwlhvfmhi{jnyigmj{zkkmnig{vjveg{jkgjinhyhywkgywgmgiigfzfzyfkgkmxwxhzfheigxngifmnn{hevxyjkyfiefifkizzhvyzyyfxnw{myzxzj{nvfivwhm{igjifmjxfmz{ivwwxfmjke{n{zhvmwevnwfinw{{evzy{ygexjienwvyjmfgmnwwzxzfee{zzwgm{{yyzhivwygmiknhxwvnfxfkvwzlv{zhwhkegzyyiizlmjhvgxiewjigvwvhhxm{{{hmhievjvzyzxwfhijifkixwjegmlfizwvykiekeghxvwmwiiivezkkyywyvjnwzwmnv{gknfzzez{w{zjem{eihxegjkvlfeeekgeezfgvzziiwfzymfvn{wjgywekwnylw{jgxwyjivkeznexwyjvgzhvn{kkzygghvfvnyjkee{jnhzyzwjkmnhxwyjxn{egn{yhwwekjeegznigzjexmnggheywn{z{hivnxfmnegvykmevixzxgiyhyykmfkgmzfgeylnwfgeenfivwwizw{fgzyegev{vjmjxwhfggihiegmnx{je{zvl{vfkhejzjxzffvy{vyjkjmixxjmlivv{jzzjekgx{j{fxym{x{jmyhixgexywnwhkgfe{v{{vn{yzfizixfzvjnwiejxiigxiv{iwhvfznwhhmjx{wgmjkwlmjheekevxjzlzfwyeevjxhgkhxzz{wixgkgzxy{hx{fgjgmygv{hhinlvhjzfxz{y{wwnh{lyfwnevgkjgm{jx{niekejkw{znixhxee{lfknjwwivnlmjvjhmwnfihi{mz{{n{mhinlfmekxnimyfmhevmwm{fkxhx{xynjznmwzwzhhe{vm{mjjzxwggnlexyyjvx{jkwnvykg{kfijzxhyf{nzl{iwniiggikzxjgjihvvlxnnlxnnljg{lgmhinnzznynwjgixvhxfjewygkhxjxjiwlzn{kkmwwnhwhmlji{yjg{ljmezvfxwgg{zgivhfimjgznnmwmy{k{z{lnfig{jzhzvzwhzjiynnjwfvwylvjmwgg{yvwvljgjezfyl{hxfxjjvvynlx{zwyfzyxlzn{wgv{jnyw{{ejknf{nxnvlzzzwkeznzwxhhvwfekmyfewyevy{hz{lev{ixnzfiiywgmjxzfjixnei{hvynhzz{vgexhgkvnig{lwwivvw{nvf{fjixjxhfxz{{zemjihzeikmnjvfevjknywywwkknhivfkmwnlhvxhz{mykkhv{ynhezynzhmjjgnngmnwnlnjkexfxyn{zwhekmwfy{jmxhgznyvfx{eehm{{mlznfihkmf{ngvhzfgfkzvn{hvywggvyekxykizyexigfinjnhevfxz{zhexivgkivgkzfzwkemj{lie{gn{zymnyfn{zyyyjmkmge{xyyvwvwylmlekmj{mnn{wwf{zkgz{vwy{gizw{{yhzhvnxjkgfenykivwx{nwfmywezjgznnf{xwhhx{eyhfmgz{ev{kmww{vfgxhgxmwjxjkv{jigmzlem{zwyn{gigv{mylez{j{feg{iyhgzfkfkge{ynhvyyyegixvhimn{imeewngzzwznny{jikz{hgvlkejvvyyln{yfieywyj{wxf{vyfy{mhvweievwlz{xfwfwwkkxhfkkixjxnvymfzxki{kkinyjgkgimjiwyxjhv{khgjvzfzwhimnnw{mwfkm{mhgjgynynzhynyfjmxn{kkg{heefky{znxnmjhkwheifgwhvhxwxnkkv{jv{niggziezfeevlmjexxhgxmffi{{kkjewwwlwjkigvjehgjzzhzwznkmyjjximiiekvwxfynyyyjizki{nzlkgexzfhk{j{fy{jvjizfzhiev{giv{wnmj{xgg{jeeexvffvwf{jnnhvvnwy{ygiggnfvwyliimjevzhxhxj{hzyvwwhnh{f{wzv{nnwkg{vzw{nnnw{{iwfwwjekezxiiwnvjzvjxwyxw{l{wkihzei{hfieiegxwixhmivfkmnz{xjhvvfkgxhikmwzvhiixekigw{ezigywexnljzii{yhegkjvegxymn{yhegzemgvx{ivki{wwhm{hmzz{zfznjxhz{kgzwzvnwzxikexmfw{eg{mzhgmwyzyzlgvginlynm{hvzfyjvjx{zygxyw{hikgkzj{hnwx{gxjgwfjvgv{vyjimvwjmkmfzwnv{exnnv{wlv{gmgz{i{fhk{efvmjfxzhfejzimmhgex{ezzhgxyjxfhvzlivjxz{vwfew{zxemkmegyw{hjikigg{e{hfzjzwnmywhmjxlmnekjxzljzwhvwzjzyixxlnnjkmyke{ziemwhv{yhvfxkgevwwwhieii{kzjvynj{{zv{{zf{jwleefivy{givhz{z{kjkzvzwivxwyf{wzxy{ke{g{likmjxnikwjzwvhhgmwfkjzez{ynwyn{lylw{{l{xnwjkzjjkmh{ex{wwiikgmlvnjm{jmj{gexhikgxh{vjigk{ehi{l{ijmmlimke{jjewhjvyhznjmnhkgwyzvhxeinjzxjmgxgzmwyhjvyf{ynfhefxyny{nhzhwjyhv{{negvjimnwezhgn{ivgmivgvzzzvzwixwwgi{yivhgvfiizj{ngmfmeegizwjxkinlezeefmylylfiivnykmnjevxfylhxivnfzwvnivizkkxlxjwffmzyzjnygmkkn{vhvjjkzlemgmfixnyhkehvixjmjeexizfxznzvmj{{jzwwmliz{ww{jknjev{n{j{kwh{x{jm{zw{jvffifehxwl{kwwegmhvjznzjnfyf{nvlm{kefknjzjfgkkev{hjmjevyzh{xgvhkz{yhegmwzlyh{yevfexw{v{fnfwhvyixekexn{vlfvgxv{fzjvzvzh{yeikmw{fxkm{zieeexfvy{mxlnfjz{wxyjzfvgz{nemmfzxmhzjiehiiz{xignlzhhmkexhki{lmhyf{lmjzvx{feie{xkejkyjyyfkhxn{jvzyhvhvemvygvjihkfggmww{lzyy{{ey{vffvgmfeny{{jkz{kizzwnhzzjkivynnjzn{immfem{vkmvjz{zyxfyfyhywv{ixexz{jexhnlvfjmm{{nnlxhxjiexhgiznzh{{egnwkmhxggggjewfjxgzhefegzzjvh{{{vmyxhvjvhzz{yzxxhzvzjznjg{hwfikwlkm{lzjnhnwzvzvizizjxv{{zjmz{igzhz{{ymnhexhnfvlkgjmjvm{zlhznj{xjgfkww{jikegfeznfmw{ezhi{xznzxfmfkml{yy{{mhvkgemjvvfv{yyjegg{mmjfkexgv{mvf{vhgmyzy{e{h{jgeeenhfzjkhvgexwieixjkmn{www{{vhxlzyzzhzylexzlvhv{yf{y{xxfzjmlzzzvjxnynnzwzwgv{wzy{zxwgveifmzlx{ylxhhzkiivvnzjhvvngk{jizkkgkfvhk{kmjzn{nmnigkinfixnlivzvixywynzywjfzgeyjzhylwyzfzwexmjnfxyivz{nnmwxyiiyy{vfggmvf{fivz{wwkghgfifkgzevggnnmfv{ggjegxjzxfwwikigexyywfnlkkhgfejzyfhewly{mn{{nlivigzzm{xn{ynhgmvlyn{fyleimnjmz{x{x{ywhiyyvhyy{k{eizggxjmnvhgveijxizeg{yvlexfkzzjzxwhznyfvfkjefmhvnwemzvzvjkwjwn{yhi{{ynhzjiji{{mwmfylem{gggjkv{hkxj{n{m{wxheewf{{{kfizwkmywnj{lxlivfgiikk{wvhkefmyfzwigkgmhvligxfzfev{injzjzfhxevhvvhfefzzxii{vkkxhgmgm{kwyfejijkzjwfgmkknhzw{e{hwwwhv{{xkizv{gy{v{xjvjnj{zgxwlkehzexhzjmivnh{{fijkfgfveenwkmnjxy{giewlikmj{{kkfm{{kmjev{fenlgivnjxz{exfiizxwjigzgmjmzn{vhkgxekginj{ggvxnw{wywlgzyw{mwh{ljifgxfznjzy{{{fxvjez{izwxnnhz{jkwyyhvjyweiznfxy{zzizw{ee{lhvy{mykiizjexwjkhm{ikgw{jz{ljgzxyyml{nwwzjjxgkekwnfzxhhxyyvwfi{l{xwfzynyiemyikem{igkhgwf{zfmxyynmjee{zfm{vy{mniz{kignykkgiivjxxnxhkkki{jy{xnnln{xjgxiv{xemywvlyyn{hk{nevzwvhgvwnnyzhezfkjzmhgvimegjvzyvjyfwwwh{hgkw{{fzf{hfvzvfknjjiyyzjmfizxhyfvljx{ywljkynkkyjivienfwfmwvymyzzigiiwlvfnjm{mhzwwhml{wzwylfgnjvlnf{wikevgeywwj{vigeejzy{zfvjixgvgkn{znmlylwhywww{ggkgkxy{ekkxjkmggznggfm{zjgnnivvnizjknnzlkeexvnv{jkemvlig{gjmjgxnfeegfk{vhzhmje{iegfxhzigizfgnffzgixhzwnhxwzyevnwvyevxyegjgmfhv{{fzjxixnwgx{jkeyygzkgyw{k{zgi{l{wvljx{nke{z{jzyivvwyyjgmnzy{jhizf{{vhxf{xnwjkgxynfvnnkgxw{n{xyn{h{vv{eejgnjyheziviin{ylxyxnfzzxiimyylfzgmgmzwfxfijifxylxwkizneehmzz{w{mjvhmmlzl{gzliefggvvwvhkezlex{xyyylzliez{gvfzzhjvzwwfmfzjvj{imn{xji{wjgivfghgievjekexzljvgxfegigvvjiziegvfzkmmnegfihxzlikkizzvhmwzlfehxegnfyf{efmjegeixizkixfznjznnmyfkjxjizf{fmwiijvjmwjyjwlfgmw{nwwikwj{iizggnlny{nvhji{jik{kv{jekmxfw{mnmhjx{zxyfi{vkkix{vxwwhnwigyjwhemizfixf{kkkzhx{gzeehehxzvfijxex{yxn{mikzwxjmnz{ikigmhjkgzjzw{xyvlkmwfhz{ykmyymhvhxyegeimfxy{ygg{zkev{yhhxfixjhm{fxngiznyyjgxlmykevwywiejmwwyl{{yyizkgkmyfkexnwhxjvwfmx{xfml{g{eixvygzz{n{nlnfvwnfjmiey{nfmjylkiex{wnjmfzwxfn{{hmn{{gvywfehigkhx{w{vhmwnevv{ynn{vf{{vwkehvywx{fgjgevwlzvvwyl{nzwxyvnhxhe{jegwhfeekx{{mfvgewwzhxlyf{{mnke{w{xezgz{fjznjwjjvjk{m{hei{x{w{gzj{himjeyyzhjiiz{zjeyfiznl{nyjzwkixlhmxyekxhikw{xjv{gzznhzzf{mhgwlxlx{vyv{hghz{gxlznjmgiiijinlnfjkezxlhxzhjz{fie{y{yml{xvy{hnhkkvymyzwzl{nhmzyfmikmh{kxjmhml{vxffg{vv{zfjkhzjevyv{ikwfyh{evjhi{zzhwyxfvygmgxvwfxixzhjiiez{wyki{xxhgkfzfkeg{nzx{jgv{ejifm{kieylvlmyjmnyvhzjivyjekzy{lmwvlmnwlkkzjvj{i{zwjkmjzzfikkkfvimzzmynwwyznylkgiiezfkwlmf{m{fgvkknyjkylzygmz{{gn{jzkm{fnnjmjkwjemw{jvezmneimlzvzhvyimggjzjmzfzxzjhmyjjvhmwlx{zhvhyjhe{hvwivynjvvfn{xnkifggkwfigz{wfwnvfevnjimm{hieihxzwik{{vnjimfmwnwjkjmhxy{xwwwimnfkmjvjvnnnlheekv{vnyhwl{{gmjzhvzlzziizfkiimfkhmkekmjgkmfxzvizeegevnzljzfkzy{lkgynyjwlyfnhx{zhhmnhvyfxmlmljkzxxn{kkgvfwjvwgvnhmnvy{ggzjxyhikvfkkkiixhijexlmnmhki{wfm{zvyighmyfhxnwem{fji{zievhgijenn{kfi{lkgfekmyjgxz{fmnhfzmnv{gmxjjxfefeekkmzyw{jzxnevvwikjieigky{fihviiynjmyjv{gmwnmhee{lyfx{znwffvhvyhexnwwnggzl{lxfzf{limkgixizfeiijmignlzvzww{hm{nzx{eixggzhkmhmfivhegekgkhxmhzjkey{gvfgwlxyxwimee{jw{hgjm{vjeignhvfjenjz{gmjgimfkvnhmxjkkfexljvyyeexjix{jmn{gmhgzgvmhnhmljinjjxyfivemx{nlfigv{wxnnlegyjwlvfvjmhfvyh{hmfxlyhgzvlnheiigxhjxjeevzhw{yyjiyyjejzvlkiwjezvlvyjgjmwnezznhvwyevny{fkigkjewyvjiemnx{wjzwx{kehkhx{h{nvf{ywliiwjhxm{my{inj{kfxmjiejzfxwfnnjgjzvf{yjijzgegmvhhkwnw{xjnwfm{hwnfgzyevyhhmxjkkww{yxfwfvjfimlxf{iyjgmyfegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyhvhv{zyfee{lywgmjxkmvjzlmyeggkxjjzmlkmeg{z{fzn{vjeiiwy{fhehvjinjyhwjzjn{fevf{zvjekfeezxhvwhihifmzhzn{gxlyfhe{vix{hggz{{hfvxyfekimh{hnhnnivheixkmxyhznlvwzxvfji{vhggv{n{nznnnfizzynkiyljxgkikii{{hizlfzyyhmzlyhyhvlfgjgixzzhinnnfegvymnezmfggge{{{jz{{gji{mfvmlzlfgxyml{wgizfvnyhkmzz{yzxvwfgvnvnzwhvmyzzzjgev{nlwnmfgzvyfzxwgeyh{wgggvvhggizzheeeijx{yxwzhfzwfwnvjmlz{hm{{eixyzn{mmyvfkifeez{fegizgxv{{nfzhehmxfzlwfvl{ly{nnmwxnjvnj{ejinjjxkexh{{vyz{hzwlvfyny{znvn{ezwjvnwzzjvfz{kfmwhhxhzznke{{xyhennmfhkzzjzjmjmvlkgeefg{lekkey{xjkkikzygz{hzhjmke{gfkek{ygifexyzwjzfigxhgkg{eeijzx{ikmhnwgzhezwn{gkzjzlxwjgjmzfkiy{{nnjynnfx{yyxjnlzhw{{iiezyvnyhvjxnnjjvvnkmfvwyxfyjvwvfevzhgkge{y{nkgkmywkegvfvfvgg{kjx{iizkm{xgzhiyfiznfemy{wn{hizjiezxjgxml{ifk{fvfwfhxigjzjx{xwniez{kgyjvhwlyjfexfnngijxnjiviehvwwfzhinlynhv{vhkznhkvy{zwnnnvhmwjg{hyw{k{gfvjzjzywwfzfzlivexmn{fxn{fkgv{jezvvwm{nfjzhinlemkegzmwwy{w{lw{zn{eyhgv{hgveefzgkiz{gfv{nezevyhn{nymyeeezvfmygmvyjkgkwfxjgevwjzhgzfvjhimwvwjvekegzviznlev{ynwzhxngmnnixfviihxeennhmkegzmhhevleeyfivvjigkexhv{jvfkyf{z{xiiiehxzzexxwnwnjnwyw{w{ev{hvmjjkmywnzfzzhmyjxhnyizwjw{wfjegkkgw{jizfkiwnwhjekivjhv{whkmlzv{hhvkmiez{iifzzywwkgjgmfekivfxfmwlzyvwei{knljx{mkijiix{{ieevvlgxfkzzggfejegvemiv{wfe{lwneihvjm{y{xkgnfzweefeexwwwyegvyjvkgvnhk{mfmixwljzeijgmjzwfgynnwjevwnlyfjzgxv{jzxjfiywjvee{iiizzvfezzlkgeimlgvvligwyvy{vhmkgezkkfvzznynj{xigzwvngxivzj{kiikevljehevwhghmvnjex{{gfvznjmmyjmjv{izwxjvyy{{jxn{j{{hxixjmig{j{yzw{m{gzjhghekm{mzhz{wyvjizfgkgm{mlikhgzjiiegikfghzml{ffgnj{efkexwyexvjvlkgjgemnnmnfxkmfigeji{jke{kwhv{gxwyjkz{{ev{kgzj{z{gzxfen{whvl{v{iv{mwyjvljiiz{whxm{njz{v{{wmnxnznkijzke{jv{xjn{hihi{yjkmw{{vw{wyhwwwjgm{hjxyjnlggimzvxyikhkwhvyjijevhmynj{jgxegvyhkxnvfynzhw{ggmlyln{wh{mkenn{{exmlyfylnhmykkw{{iixmfylv{wwkmzlzjz{nln{{kzyvh{yvn{zhmixylkkwj{gegnjnjyjhggmnfvjvn{vnwznhxigfgki{vimvlhmn{vljgyf{nnyxl{fvwzj{iv{m{{jnlivzlnjyfvlhkhv{{hgemxwkkmlyfivz{kgjm{yyyekfiwheg{xjveizfekekyjegxny{jgy{v{gmvfvhx{fkvyii{vkmv{fgnjfmwwie{egzevhgixy{fmv{zz{hm{evxjylwl{zz{nw{hxjhknhmnheikz{zygggegv{wmfiznj{k{kvfnfiv{gee{jjvkevhivjekgggignwikiv{vxyhgizevjiggzyxw{wvjikivxfzjnfwhegfmfzvy{jegkimfkiizyf{hgmhimh{meezneghxnjylwjwfnf{wmwjxmyhmkgezvn{zexexhzwlvjevmjjkjizxmnekezny{ezjimjiimvj{lwfvfyjhznj{gwykmzjexixhvfemnhxfviijv{xixizxjzvzyhxkkmwxfgz{yvwizieekmhfmkeemzy{zzlzfnfnfwhhm{{xjwyyfexn{fihzjvzjzhkmv{{nxymfkgxjyfgvgzmfvnnwyhfviixlfgexhxwfmnnjxfvl{nfiimekegzvvlzlznkkwy{{ixjghkkkxwwjvlvygv{egvjz{gfz{lv{{xeemlix{mzlzlywxj{vjejzwfvjvh{gzvxlzynlxymnmlyy{yix{nfi{nnw{jeiem{lmfeg{hxjxym{ywgzx{zhhvnyyyzngmigww{gmykeyhimzykmgihemnzj{njigmjgfivfzx{iim{mfxwykezzfzjxexzyjkfx{kv{nfyjznmwjzez{v{gmfxfnffzvnfiiehxzjyhx{vlxfvnikzv{fvfyyex{nzzgznwgkekwnxykkwhzlxwv{{zzn{gxlznxlgi{wmnv{{h{ffkmnfkxnyyzznhhzfgmnn{gi{i{fxfw{he{wyljvnlwhivjmvjxn{jyhx{xnnwgmy{{eywjv{gnnjvzneiezvj{z{wex{nfxznhxnygmhiee{l{nkezlwl{wzzyyw{vyvfwjki{ev{{kw{jzmyyy{jylxnnnvnzzggvyvfjkwjmjekml{hgk{k{kekkkmjzj{nzfjexlheevhvkigiexkkhieifmwwmhgiwhixiv{wgkkihmxjkkezw{mj{jx{wwfzynzfxh{jhikgm{kijmiihv{ywn{eevhk{{njjzfzeiekekzziinfvyw{gzgg{xvyxjjejmmhhzgkigfz{zn{xly{eg{livnhnlvlzhnlgxvnywzngxnlwyggnhjvz{xynyek{ehz{{fvkigkvfiggzji{nmyjvnfjmgvwwzjgxekzvxl{yeev{einneeiixy{ymwnf{yvwek{whz{wnwhijgyfwn{gjkxfmyxnmyzlgkzznynyfiheyffgy{ivxnvj{w{kzf{lnjwhxfw{eejgzhvhzwjmvjexkiiiznz{zj{yfmzlzyxhkihi{fzjyfyjeznjfknh{wvhznfzfzmfhzekjmwwv{zjfzylimfzjgemwh{{vlgmxjxnwjivvnhkjkekkgxhvniiwniznhzvhevlyhmngm{{iewynyjewnxhggmhjk{xjzfizn{mjezl{{{zmhzxnlixzhzn{ejknhn{ekkexnhvfkxnfxekwyzxjefikkvyvh{v{wggnlxfgennemxnjk{xv{whjzvnvfyheexhmfzjw{gzkgyw{kwnznx{iewygim{y{ny{wzzfmkgimmynfzhek{lmygxzyhxwjeeyyjxjxivzykinnzhmyemyyvwhizlynnfemfgvnjeggfmwygvnwzvyf{yei{mzhizmhnnzlggzvkgexnnkkeigg{wwhkevhhxhgwfjmex{wyfvhvnmhfmvlfxzjhk{nfxxjxww{{egk{yix{{hvy{njkmyy{x{{zwxfkg{wemfzzyezjmvw{ynwemz{jinlyygiizhvzwfkgekkkkv{zvgiyykgyhvhww{n{vzzkehvylhekihk{yx{igzzmj{lmnfm{mkkfkznyhezkmzvmyfmkgyfjizf{f{wz{vljzywv{hkzzzfhzfmxywnvhy{z{kghviv{mfz{x{wylkmmyvnizeim{kkhvvfgx{vhiyfhvhehzggnnegzw{lxlwfhvjizyfexyevzyzhzn{gxlzxjmgiyjxfwnmjnlgmgzfehkhk{xeeixzwhihi{nz{iey{{zmw{fxhz{xyfvezvnfxxfgk{imyxyhew{njhv{vkg{veeiihvxjvljinwwhigjzzfjkww{vzvmfz{{{fkfxjiwjzwjxiiv{{wvhfx{{wjjez{fmeemlmjfmjkfmxhjxhvzlkmezkivjylhzyyzjfmjezj{jyf{{kkfznh{i{xznvyhvyjjmgeizmfmjgmjxfgnyvy{yivjixwz{jgvynjxhjikkm{ikvhvlzzgkkmywhvjzzjggmhxyimfxwjekzleknnjgxhjxjgjk{{hzfinfnwzygiwfiizlevhihzfxzywwn{wyekhzhgggxwnyevhgikggiv{ivnxnnjyf{hhghgvyyl{xexhkzzmwvjyjyj{wyyvl{nnj{vvlfexhnjywmfxw{w{wkifxmwwhegee{gnh{i{j{mhm{ygz{xikzfkkikmlvfikfvezkgwjyjjmzxyyzhnwzn{zikjgnwhvzfevznvlv{jvmjgeikzjgzfgginwgvikkiz{kggmyhgx{ywhzwjgvnwfz{jmevvjzxzwemmneeiggxkenjw{hvieivjkynzjzj{wxlfivn{kv{vwyjxh{yfgm{vwmfimzfhehijgfezf{yvyzvfemjjmezikkijghznyjkexjixlylhzwhheezwfgzjxgzfekem{wwxy{vgxzlexfmgizlnfn{zwegkmvhkgmfxjhvnhhvwwkinh{mizeiyjyjjzvfwn{hfzigke{igv{xgmv{ii{xvnvneeevy{ylmhxlimjkixyjiz{nhg{vginjfv{njzhexwkgixjgeeevxh{nmjekemfvgkylwjmffgmf{fvnmymjiv{nnhgihzkexwkiiejkhvzlxfwhzjvhkehz{hxnekmfhiw{nny{iinwn{nljgwnywgmfmmh{j{vezgmmjfx{ivfhinn{yzywykmvj{ljkynjmvwvfjkfiwwhvhxzwee{jnwfzn{v{ylzhki{wmwkkzwjm{vn{nhwffz{xzljeyny{{{whxwjkyjvfezivfkjzgmkmx{ek{hwjnf{jezkizhzlvlzfgefvjg{xvj{f{yeey{gmyywfgz{{{mzzzwjvnfzyxjwynfgivfxljeivjigm{m{vnlyhwnhzegvwznmf{xexek{hhevjkmkgkeeexfhggv{wexw{jxx{jeggfz{{fvgxy{jkmfxhyy{emfnnvnnlxwmfyhigkmyhjxznmjimxfnffigvynegnl{xzxwyyf{lylwwiizh{wgxhv{fizzx{nmj{xikfm{{kk{iixkmfxvhfejimwje{nxy{x{zxwyyeexyfegvjghxjenykihxnlhvfkwn{{{hvyfivjmfzlivzwzzkkexjmm{wfn{vh{wez{jzxfvxhzzyyjvmj{lgx{hmfjmiifzmwxhwygzgv{wekfikmexfe{eeiiinf{zy{znm{zfiizfgeggw{vnkmzh{hzyfgeijiywjvfxyjjkwnyhizgmhz{h{nnnxh{yhvz{jikejvmjfvyfnfhemjkewjjenjyw{{njiemjji{egmyhyjmh{v{jjknlnjwynw{ifzfvhk{n{vgmhmm{myfkv{nlyynneiwwfgvyfx{gegeeieywwjvjjemjkghiyfwhiiwjgmgimwikjxhijgmyvw{k{imhnn{{z{whmnjk{xfzjehvfxnwmjjkgxjm{inwhmkenw{jfejgfv{gfvgmigzvfzyfjmhg{em{hifeyynjzjhmylvlfeegkmjghxhkyhfihmjzjg{knjhxkemwvwzzvyfzw{nyv{fkhm{{gkkeml{{nw{xm{wf{yfmimy{fiwjgzigwj{nfijm{n{v{xfv{gwf{n{fnl{lwfeiyfznzvwlznmh{fjzgmekxhjkzfhvhijijgkmwheeyyzhzf{w{nmhz{{zkkgiyw{iie{jmjkgkewhzlkg{ygex{wfz{jifegzmlfizxevm{eizw{{hknwyhjizw{ihkfvieikimvlhgeinhmn{zynnh{yyhkgjegzywggfvvlfmzvm{yyieemhxkmkgzj{whkxfzlhmhkezvnixfmzy{zxfeeyymwhkeznwxlggvw{wfv{fjiigznnh{lzvzjzznfivhg{lixkkzxjgxfjvhkfziejmmln{ji{nxyzxynzwnwgzjx{hgvzhkefxwnfghgiejvemfgwyfievwjnhimnj{hkkmlgmynkgzffvfikgmj{{gmegyfnlzlxh{hmjfehkfvmlwfmjev{yzfzjwlmyy{mh{kgk{k{kwhxlhejxm{hgwyhxy{jekgjzfgwjnnzzmjfiggigwwfmkmxyevyln{jikg{zyyyjxjkenyxlzxeg{nzfw{eivjgmzyzwgzxwwhgezjmhwwzwjmzy{wm{{ew{xlvl{mnwznwffv{lzjw{ywfgfzgmixjxwfhe{gzwvf{inlfvhxyyvyfgwj{nnfzhxw{vnyzhgghxfiyhemnfek{vhgynkm{w{jexhmhxnfhxm{yhheyleevyzzkemnnhfemfmywnhkkkmnimnywh{h{yemvh{ljgixnhmjevfgvyzjyhvl{f{xyymyjmy{ekikjvhvynwjgm{ezjfkemezie{jzy{lgeevyynwfvjxyjgkvlfekemjwyevjgwlvyjzzfwnxygg{zwjzzfe{ffinfek{{givjixvfjkzx{kgzz{{fkgnn{yekmyizvwyw{nzxznjx{zix{fzjvl{emj{hznywzxfkywgeizvfxjywkmeehmgi{zmwhkgxekgimwy{ywjkzfzzxl{jww{vgkjmnyizyhmfzfii{hkekieizlevyfgzfkwyfgjiwfmhnjixfefkfzemwfhe{g{{vjvnkmwyhxievfhxjmgenfx{ixyjvjzfggzz{nwfhgimjimfyfzwfzkkjmfkegekvwikgx{iwwkijzjzvwnwmnemhmjzhmfzmj{ijxiknfkejgem{wjgjxexzvnnywyfv{jmizy{xy{jjejejm{f{imh{lmjfzkmvyw{nhmhjmylkefifeyw{hzyyfw{ezzjmwkewfwnvfxwvhzlv{{{kkxww{jkx{he{xmjkghzwnhexnhgfk{eimznzyezevek{mylgmzwnhzwwwxjmwjikghgnhzwy{v{znyjznexjvimizkgkkhxgkkiimfevlhv{vwnevekmfxh{ggigxz{zfie{neegixnwl{zhg{hggimmnzyzffinfyhkmxwfefizhmfyhjvheyjkehifxn{gixnnnkievji{ex{jvfmmfhv{wexzhhzjmmlizgefvwynhyfhxjvnnfzfkzjexfmjefejevyylexhxzvyfkkmfyhezynjg{ky{{vyhivgm{e{ghkvj{nmn{ixfzn{xiiivz{jmxwmfezmwkizx{whivfgxfeevevjenlhkxyjzyjyjy{iizyhvji{j{nhkmly{exheimivxhfxwfyjnfnwjevwxffzexhzwymhjmz{xwkmgzmnzlvw{hgkzvfkhzvy{ykeimvjkiyjzlhzevixgzgz{mjggejv{zmwgxxnvhnnz{mwm{xhex{zvyggv{{vxyvwfmggimemfzfehgfgzvhx{hw{{yvyhzzyzleigxizginjgviviefz{fhgjxywixgifvjemlwwgv{vjiwj{xvyfkixwlyfim{nfzjgzyfemfjgzjzjfx{kzjjvmhjz{ejim{wnhz{gxwgmkezfieikzfikzvhgfvww{xjxgmm{imjigxxyzlfxnnikvn{w{vjijkzvjximy{xykefgkevh{{kexl{xwjhzgzzwnnxn{miihznljexfw{hvizmjxhieevzx{gjk{jxngzz{gkxlimhizzvhigwlfexfzjfiyyjx{gzhkmgewhvfvnienffzvlezwfjifgkgfxmyex{mhgzzgkxyiefvmjnhzvywkmikxh{y{kvwjxkmwjgezfnheemyzwzlezvwzhhenj{injgg{eyyvfjgfxv{ikmjgzjevhvwhxmhjeyfzjkenlighmjinjegw{{m{jnfggvjmj{gxjgiyljvjewyn{gmm{kiwhzfke{zmnfgigggznfiegmnwljximwj{hggekjvxniiiigezhkenjmnvhxy{ljkxheijmeeiivj{lfezngmzweemwfghxfeyhzfimnligexemvjylgg{{yjjxkm{hvl{wgznjevhxjinlfg{kvjmwjggxhgmljzeifgxwm{wlik{lywmf{mvfy{vyzxjiyjexzl{vjehkekxyhgjmfiyjhzvhfkjiwwkifm{{v{nlkgv{fgy{fzjgyhwwiknlnlev{i{nwjji{fzhezwl{mvjkiwlfikifmke{exwywjzw{mj{xy{imjkwnzlizylz{ek{igg{kvh{{nfnyz{jgy{wyxjheizjizyjkzjivnjemfx{yvlznfikmjevwhezyz{xjnwimkkhxjxhkgxwfiivyyh{l{nwnggje{xfvmfwnkm{nnjxyig{lnjki{l{ejknlwjxjhkvn{{eexnfxgmjkjmvhhzfznwmjexmlnhkkimnyvyjeemiiizzhjxnhnh{iyh{x{jwnzvznyfjenj{j{mzwvfggzvyfnyje{gekxlznyfnhhknfkkkkzvwf{z{f{z{k{i{mxfnfx{hxfgx{{{{wemhzhxmwzh{mxhggjmzjvhjx{n{yynnngmfe{vhmgmfzmjjvzhzzfgfixh{nekezv{jmkgfkzzhevfw{zlwyig{nx{kkzwvyxykkxn{ejvvj{nizxyjxjefmxjhzein{zxjeezzyjmwyzzjmmykg{n{vjzkeznnw{{fm{ggiji{niizlwlhiyngkhgnnv{kkw{ekzlezywznynkizfyfywexzy{fm{eggizlyyvnn{zfnnkmmlfejmginfwywjgizhfmylw{{kvleiezvyyjwwxfemznfxgi{xevzx{kfmfeyjfzjxmwnykehvxjekeiyhememfxigwhhifgn{ekgxexixfgiikkfgjmzxvwfmjvik{whmjzjvy{nlzjjmkkkiyhy{yl{{{n{lgmmy{wjeee{{{fmf{fjxywmhzngzikeimn{nn{jxgxhmimkikgynxnyjjenfhvfgmfhmzhzynjznhkkiegw{fvhkggnyvny{{fkgnj{zzv{ffizl{yfggxzyezhevjkizxhgjg{fkeeekinn{ezxjzhxgkxnjkhiy{nlw{ynixjm{kmh{{z{jxjmggxwylvw{v{j{khzynwwnwkmw{ixixzjnweizngmzjyjgmjeegxwnfjizn{eegyjyjwwxyfemhfmm{xfizyhfzjxwnnygmeiw{jmgmixvhgzz{nlkevhvleigxggjvvhge{hvnjxvjnl{mii{nwjfvhvjmyhxfgxizhxfekejkyny{yfvyvf{zmh{lxygmhzw{yjkgiknwywixgxjxxhhxzlvy{y{ykkn{igjviegixhzw{jgmkgz{kkv{mhy{{nzyy{{fizjzwhmwgvzhmfzwfv{{vhighmgxfg{lnl{jm{{nm{xhfkyn{xjizjnjiifxhxfkjkevgijifgjev{vyxhigmlikmyjzfeexixzhkkgixhwhfzfxyf{xmfke{ekey{mjmljvmf{lnyvlhigxkk{{{yhz{km{gzjm{vjmei{wzj{evfgeywfmmwfmznn{fgkgwjfe{n{fgijiegzlfkkixyjimjegxwxjnymhiehmvnfkfmgghvzyznzfmwfemwggmffmiigi{ngizniknl{hyj{wje{emfkmjx{mzv{zjk{hywzhhgiev{{gez{ynhjvnl{iekkmfgzxfvzznnvjjzwjkkeiiiyfkkfgjxegek{{kg{vxw{ehkhvzfvnm{fkkgemxjfe{yjkyj{eynxj{k{nznvwnhxy{g{vmnmynl{hny{jfi{zzvkmnwzxz{igeg{nxw{njmekvfjgxwhg{vhzjgwyv{ivezfzegwjgznhnfkewwgkfgezvffivwvnwwnf{kvfw{mwyhgihznnzhekjg{yzymjmyhzxyvwyy{ghzfix{vffigenyigvfigkkjgzhkixlvyfiwlnnzfnyhgvfiz{j{gkezyhvxhhzfkgenfxhw{w{jg{zvffvz{hk{wylnljvgzyfvfizzyv{x{ylzliemfhzhmgzwnkejx{xywyn{h{zgg{{igzxznxyfe{jvnkkhvwwjz{xivezkezxkmvjz{gmzjimeihijehmy{jxzffmevivjejkvn{jwlfzyyxweigvemjew{jkzzw{{gnykkvljgvjgzjxizkmnn{k{gev{v{xigzvgzjvfkylexkm{fhgivgenhnljx{wyl{nyjemxfzvmwzwzjeeynvhwwhvwfnjhvyf{{hi{vyjn{fmkenhyhgzfgvlezgihgvlhigvizhmvwgkyyynezvwvfwn{yfmyjhz{mhv{jvy{fhvfkgehgxhiz{j{kzwjiyjyywwjieivf{mhezjgkixiexjvwjgfznnzxei{{n{m{{j{xkmigvjnlwnw{ixgmzxeinfwlxl{{{lvyhzfznhmyjxw{hzx{ge{infxlimfeimgeyyvhki{hkgxlkmvh{wjemfzhvjgzyyjmikzvkenn{wekfe{hmfwl{h{ljgwfvfjgzwmfimjxievwggxlhx{lyygghvjxjiww{nwl{hzxz{yfhzw{hgww{vzjgzjxnnkmnjjgznkihige{fmwhifkynmfgzv{y{kkwwjejkmnjgzy{yy{zneigxivmjzvjxeiyj{ivymwheizvhjekezfixegmnjveihgxjylyfzz{xzyeihkjigiwyggkmfxnwjznjww{nnjhixhy{iiwffxkmn{zfvjvh{jvlem{hjvkgmw{wfznn{e{ivnemfz{kv{iknyigwyezjkigvhzxhznywwixkeznekiiheixnwjgvwgxw{zleewnzyigzjx{{fjehigmwnjvezjezlegegjejxnwnjyj{ygiwwzj{jfe{lzw{hnj{kmwwyx{fvhvmhkeznegfk{zwnz{{njenhzfylizhenfzyznfmgvjz{z{hylggvfexhkwfekzxnhkmhgggwjhmjgiiwwfgznev{vn{mngmfkvf{v{vjkhvvf{iexzhywxy{ejmgg{lyfzwxlhvnlywjkyfgmzn{niz{hznynynvyxwyweviieemnm{kkikwnylkkxhfvhizwzfkgfzyfjm{lem{w{kgmnwy{jxfenhn{fkzhgvz{vyeewwhxixje{mfzikhevnvfnlyyezfmxhhzjkgmv{vnwffifkzh{w{zfvkmmlyj{h{lvhgx{xy{wl{xyjxfvfxhimizmy{kgeizji{gjzmneehvgmz{{{jxzjexgzjznn{kgkfihgexnjywivvw{fmhxfyf{yhxiegmyhizzzwjwjyl{nizizhxzywhjmxlx{xhjx{zegekxh{xvwm{fv{jvlegikiz{xegjg{wz{nwjkgvmj{yvhjxvyyjgiyjyw{mhz{vfkxnjgizv{z{wjfzhemnzvzyighzjiiv{{{wnjxfjzwnhvwlgekm{jv{{zyl{j{ykmnjyyekjikewhxjge{vkm{gegv{zygzmnmhzwjxy{kmm{kggzzfywvhzhhzkmwyvhiefvxliijejmizywwn{mzyyfyfjifxxfvwfx{vxlxfkk{nv{evfkvnzzegmh{{ezimylixjkywjzxfw{gkvnz{{lxnfin{w{xh{lgvkenlvy{ixhjkvfggjeixgxxlfkginffvjzigimzhjmmyznemhey{zh{yxwkggizxvnzjggexzfjgzwzjzwvhylfezymfvjgejgkevlkmekmjvyiiwynlgigmfzzxixgzwfzhznwnvjxfjkhgwl{nezexhvhv{xgxmyxy{myhhmmnhzkmn{whkgzljenlmlxywyvffiivikmjznvynhhkvwy{emjxvhgezlzhw{fm{hegzwmlwhezhxikgkzfmnx{nyxlxlnwmhienhz{jk{mwhemkigvnfge{wnwmnzjnfivznyfhz{lmyhxmhwfywz{z{iifiimfzm{m{hmeeivnnimyww{hvixfvkkvlggzhiexjhgjgxfvngkhzigevgewwfiezzyxljg{nvykexneggz{gkgjz{em{kkkezzjvxlfmyhmnhgyw{fvf{lvlgxemz{{x{kjenwvlyykmjifkhmwln{zfzwxlfgkghzevekzfgggggvz{whimynnnyjzvynikhvn{vjyhjihxgxfe{zkemhzfnnnyznvnkkx{mj{{wjmhvwnnn{gk{ggmwjmhzynlylylimnjhew{y{ix{v{hvfjxzfmyiefgheikjifgikivv{ighzfezljvw{xfzfigzymf{heimhnhwneinjjzvjgezwwwzljziv{jjkivgmeknwnn{wjizygmzn{hhzkigvnnzjhknfevnhjkjvhx{zzhgm{gjkeieximvfzjev{gimgike{x{miev{ie{v{zvnnjieyjevwnevfgvykmv{{nvywhvym{egigjmwfjgfggijkwnmlkmjgvnkm{hmjvlfvnjjezlwfeiig{jjkiiixmwynfvkijegvyjik{v{hmyfzkemly{xj{fgg{jfvjvvnjeimvf{hevkknwmfzzxlfe{yggik{hzymhzvfmiky{vjgenfmnemvjgeyngizwizmyvjwwwfekevnnmfnjnnwynhgzv{mfn{zhmhvjn{v{nhiiivzymfjkjkevikfzvjvnevywzywyx{nyzfyjwwiznnmnjmwlm{fvekyhny{fxlwfemeigmjmnwzvixmfhzjgfzhivhv{nnylzfynylzwemmy{zkez{egfkhzgimfii{hzzemzfnwhivhjehgm{fmhky{zjizhzv{zfzfzxgxwy{hhkjxhefeez{vikfxfzegznjexjgikmxyxnxynwgigkwwyfyngzww{jwlezzwvlwnm{yhnfwywyvwgiivgekgnhxhjv{n{jnyhvvhfzgxjivnvlwyzw{nkiiezymnfenfnnigzxemggivke{fhzhvkkz{ki{{zf{ymjzzhvieeekevlylfe{vhxfmfknfmfw{yffiezggzngvwlzv{{{mjv{e{jm{y{zlje{jgimlxy{{vwmnwyfivw{wzhiexfwnkghmzfhkvygzievwkgexfzjx{xvfxf{lzhnffijxegn{{yfxwhwjfgynyy{iig{{gmnhjvzf{z{vge{v{limyh{n{jegnw{jfvvykkhezxxfgvzhgggxexkmkghgmyjieixfex{yylvnn{{xjew{hgzwxnkin{fxyyhvmhfzjm{zegekeeim{zexikvlhg{{hkzhyjnhkmnyfkhkw{je{kgvylexwwnjm{fkzzznzwgmevzfnygekiggwngefieifi{{nhyjwfylzfignlekyjjmxhwwgixhikix{jwlgegevfnjy{vygeig{eylgxiviewjznvhz{mlfm{fkgzvzwvyyhfmjevlzffkjmmn{zighizlimwjzjnfvymn{{zvmfjex{kejvixfxgkkg{wexigzh{vmj{z{evnxjjzyhfe{ivwwyyjke{v{xgezfwyzz{vmyeeny{xgkgvwnfk{xhkjgz{nhfzevmfmy{{{gw{eznnzjgzhkhgwhnjkievfe{xvfjmhkxffifeylzweg{wjinlvyzzvlmhxjhgig{nzvyjjkhmjkgk{gxy{g{zxfkgxlvhxwwjgxexzzeggzx{zh{f{ifeexfkeivy{kzhvjjk{zkk{fgiwwnhw{fxmy{jmyhxevvwkmxfezvlywvwmjywgewhev{j{jwffinjfkee{iywyh{zfkgmnfxyienywnggkmxhhkkimjvw{v{nnyjg{ewlvlmy{wylkgzlmffzjmivivikjvzfjihiexhxyyezjenlkizf{wyyvlexnhzjxhzwjviezwikke{jmf{vxy{gkk{nexggggixvlie{zxnzfjzjkfiizhzjxgxwj{{v{eev{xjxwkgn{hkmynf{ieiiixy{w{kwwxnyjzzkkx{{vjvzziiix{{njvnwnyfixgzxyynzv{vvwiew{{nxw{xmf{ikkfx{h{xzxynyhmfw{jvwjmwfgml{xnhxhxfmnzjhkmwhzgvixizmyvj{i{n{egvgijgkkimkk{nhkekgvwhylnfxwjm{iemyjzhhmwwzhv{xwyljiwnvwwlvyxnyhjkfijg{ew{igzywyfvvfv{{khififvjmz{{ekefmgvjixlwyikfzx{jzznzyvnigegikhxzz{lzywwwhegmfgefxmygk{xieez{yyjx{vjzj{{whevxlyleixy{yz{geyyylzhznekfegx{zzyvyvljixyjv{ezhnnkinfhvxnhkzvvlixkg{ngiek{yjizvezwwzvyhfzhiynjkfvzyzvxj{x{igxemfzzvz{vyigkkyjwwyynlgkizynzwfk{zvfgzmyiigvgzwfmlmf{vgk{my{wfwnxyixznxyhinwii{in{jkyl{fmfz{{yeevngzjxnfgzhgiijgzzmj{ynfzhjghkxfhmzvjiikjggexfwyiiexmffijehghgn{{kyffenfivfmeimlyfvfhvwfhzimhvvf{nvhizevv{nlvwwfv{gvmjhvyjjmzxv{nfiemhx{fgmfgz{wvweifkigiggxzjywzyhmfe{hyjzlwnxl{kmhzlzfmyjxezimzxnhnnynm{gxkifkizhmxyzwgikgmj{vhvhxw{jxhxjevjfgmffmz{zzgigxznmjzvwwjghmznxlzlgxvfwnhzhkjzzlgk{yeimhfeigfm{j{w{jnhzv{{wwkg{xggfzwhimfxgzxjievly{zf{izlhkn{jigvfivnfkznyjimiiwhgmfezvjkke{gz{{hkkvfev{vmhmw{xzhgg{{{mjijeixjgmnyhhknlhmmy{fvnwyke{yznyhix{ffvmlnj{vizz{mnhizzjezfiefxigkiixhzxh{nvlnjjzgv{xekgzwlvlggkezlimyhjmfkevmlfizzjiek{zvhjxhkfmeevnvlgivnvlwywjxfmjexmngx{yvnzlz{xymhfigvfi{yhmjkvhmhwf{mii{mfeznizimyjn{{i{znhezmwylx{em{xjiwljzhey{zlfvfvgijvnjn{gg{{xhwyxyxjxyfvevki{fjmywnhwwjvzliigxekgiz{n{ywjkezjeyfzwizzlem{zmhwwn{{{njhi{lfmgifixnxyz{wnvwwlee{lywnnhgfzjxwfei{hnhggn{xhgvwjv{fiimhz{{wn{iylw{hmixjgw{{jv{{kzjvnnhgkekwnjxvlhxzlxwwhy{xfjijvznjmgi{wnlkenfjkwf{lkkgzx{izzykkmniihv{z{hznzhwyiefvkm{mzhhzxhjenyfzyfyniikkzzw{{zwn{lmjm{ylhkxjnhwyfkmhkmynzxii{vjgyfgmgm{kfievzzezz{yjeghe{gvyeghvnhjkjzei{hixnhkkx{znjvy{{gzl{wvy{wy{vyy{ynn{mnw{vykigi{gzfmnnf{g{xxfzngkyhfmxwzfwnxjw{vlvyyyix{fwyfz{xwyieexhxzneegxznmjzzki{eimfgxhfx{negjx{ym{hkzlwnjmnjfivhyyfkznwn{vezein{{fmngvzxwhvn{liveg{hz{mjivvjyymnywixekzwxyfmyhnnyjy{hmfk{wvnnfzymffexnix{kw{zwhvwyiv{vv{z{xjhkzljkywhzzfgx{hz{wwzhm{jmzjnnjvjvkmy{zyzw{negemkkyl{yjiekmnekyffxjg{lxfx{wl{w{in{km{nny{nxwvwwynjzyevyymlggfvexix{fegjgeijg{ymw{jmyylvlfmkmjgevixevhznnixixwlm{{wwyizfzegznekmy{ezfhghzxlkknh{yzyggywzhzhjkn{fkfvwjzjmjzlmh{gezmfnhzwhefgxjxnxjjgfm{l{h{hkggz{evnhxyjjixj{mgigghewwikgx{jvfzjml{xfknlgxzvkmm{{ngvjvjen{fvjgfivyhzfgyjixnffm{{jgwlmnegmffgixmfxlvjhizffehgnwjike{xxfmhynfz{jjmmjyjyhwljghkyjxwivxh{ejimlzf{yjgz{ignyevfkgife{xfk{yixyjfxhejzeexlekyhkm{g{zjxekkekijmjm{l{vkmmjixw{yyxl{nn{{vw{eg{mimvnvfwyzngvhznlynkkeifmexvfzwkgmynlyjgkywekzjiihvwjmhywkewlvhnj{z{z{lzhizjigmfmzxixvffmjkvj{gwhkmhzv{{gmln{fgkmyhylnfnyizwjkgevignykmzxwlzhnwvlgejixjzffiimjv{fyjjigzfkfewjemx{v{n{vjiizxhkgv{hgeyjzhvnexhvnlzjyhnfxlww{jfezxyj{jnfv{fkggjmgvjen{mygk{whmmw{vhvexvweziv{{fi{hy{vyggm{jkw{y{ynwlmwfi{kmn{jmljzxf{lvyjihzyj{egzx{mwhiexmymhny{vwyfmzzfmy{jgigmfiijzfixwmfevwnhzx{w{w{njmn{xyl{ygkw{{xmnemvnegjmznxhynnfekmfix{vyhzhgigvgkhvke{lhkkivyzzhvvjnwyy{e{kimylexhzzjvhyjjejkynegwlgvhkhveigvmnfmgvhixhkeeeiewjvhvhzwv{kkfigmmfgkizzyjmhgkg{ymneiwlieimnjfehefzzwjey{y{zxyjiggijkkg{nml{ex{fxfxjznhkmv{hxgzgkxwwnvl{zjgekxwiiegvngmwwegnlhzvnzfixgvwwznnfezivvhxhzf{gxlxnfzwhvjm{xyjeivixgizwvhek{y{jgezhekfeizhknhynmhkigin{kmmhhigxemz{{mem{exfnlemxj{gwwjknn{gvhwlfmgi{enyjm{hievnfkmynhvfjx{vgiyyiijgkgkm{ljxxwjk{xznmh{xylzxemivgenwjxjxkgix{j{x{nylfv{kjkm{m{znhm{j{{exivjzzvfzhzz{fxexhgegny{hjvvhnnikkekkyhmhvf{wvhzfwyy{ezy{fkjvwnjiwjikmlexgivlmhgzv{{h{wwyfmv{jmzw{nzzyfxlgekifxegwhmwimzxekkkyljiiigkvfyyigywjmkmzl{kjiemiiekjxhiwfhgyy{nzwvykgyn{hmnnnnweznwjmevhxvwvjxnighzjm{yzxwyhemlhxkigeww{zzjhehgkkkkzwml{fikml{{{e{l{vyw{hzxww{hvnixhzv{hmy{gmhzzxiggkxh{vvl{gyyfv{mzjxf{i{jiexhggivnnyjy{{fz{gxnyixznzznfwf{h{mvnzlyymhw{y{fkjgxwgvwfvleinhfegk{lxlhkzx{geegmzznfn{wlm{jgfmnlnl{lx{iv{k{h{gy{nnyj{{hv{neewnfivymnemvwm{{{zl{hiv{xmligjmfzmwzn{ywnjkvhfehkfzgmfmnfwjnyhxn{kiwlgkvfvhkgevge{fvjhgkmyfmlfvwl{v{exjwyigzlmfhzylmynhgmfzvhwwzjzxnymh{kgeezfmmhjezz{fvyzxnhzwynkkmn{lggfmemmlz{gmzyyhvfevzwivvyfgzhvniiemikvnhkjzvhggfviigmnnkmmlgi{exynf{jzvvjfgjzegheyyfgyhzhvlfmfizzwjz{vymnzwgm{mwhmfjeexwyivzveewjnh{g{kjiyngizjhgmlw{fgm{jkfgzvjxhexjhxzjhxev{wnjxfkifehkvjwnnhimkiemxy{ykk{gzxie{k{ewwfem{{{myhehiimnhjvzz{fiijzmnik{lixgg{highv{hxy{j{{{w{yyf{hml{wxygvvwgzggkeznhinhznvfex{ffkxyxlnjgmzywwkmeegmeigewjznjewyevwy{{{n{xexmhvyzjkmhijxjiixmjjeieznjkegkknnezzyjmgvvfnfyy{m{{zhnjzfwjxlivexnwynwh{ewwhvnjhiwfwjvljzmjvwxnhg{zjzggfivyei{wfv{wyjgvevmnv{zzwjjgmljvikywhxmhwlezxhkkikemzhfmfgnjhvfizfjefmezezjgzwgxvh{zhzmfnlzhvlnly{ixwhkmyjmnynzh{k{wvnexjvhk{kimyfezkgeznhyjhinwezje{nzz{yeexwekxyylzjjizxfmvhmw{vjv{yxw{exyxjm{gikenlevyh{h{wxnwnjzig{{xy{k{lhx{imnfe{mgmhvjxnwfxixfgegmwzw{m{wmw{zjzekiinykgiejefkwymf{e{jgx{wim{{{lmnjxv{igvwezwnimvjyfynvw{mgmvlfijmww{imlvnmlz{kmkehvwl{{kevwjvynigexwnvlfixjz{yyzyfm{vfemhgvkkjievjzzzx{{yggjewnvlww{yiizyixjzwwfefvgvyhwfiinyiifkhey{vhnjgkzvxljzgvgm{wvlhxkgznhvhvgvjvexgg{{vhmlxjjm{xn{jx{fmfnljennxhjkhkkeywgmhejxzwkizwnwje{e{vem{y{yyn{wyyiejk{{{hvnjznfzhzhyjhgxyix{nwhvfzynffxyyizzlhmnnvf{yixyljixlimxwiiimxhzyzzyfvfnhjvx{hi{mx{nwvhhg{jzyzzek{ggimfgiikzhii{yjejizlvwwnz{{ehkmlimmfywhkjv{x{exnvlx{gmezn{xnx{zxiifmv{hggvgzkgwnvjzlxfxlxywhwynf{ngi{{{evlginhfkgvz{zxjgie{j{xek{n{wwlwjvyynhzzvy{{eexizezgeemxnw{nlylnh{gwl{{ivexkggxmjxjwyixyfn{fkvfzhizvyemnwiezw{nzzyjhvkgfejiwnv{znhzywhxjem{{w{{wl{hzjzn{ezx{exjnjywzhjmvnzwhejg{feijkz{iveewwgzhzhejzwynwn{jxnymj{vxfexzjjmhixnz{hxwykexwixx{gxmjyhzfzhwn{yhgemjg{zyfiihm{ehmwyxjn{fvhx{{eemyjk{fzvnfyh{yzx{hhijg{fzzkkkmhi{vwwxyznyyfkjxjggvnh{jvhhzvymhxngkhgmjzhyffxgkzxmwfg{gyj{lwyeifmfvgvjxnfeekmmwwjegxwieexnlhzeixffi{lnn{{zjvwfzjx{wzhgzgzmneikizwkemh{lmjmnixhemwiiiivyikzj{v{x{l{nz{gmmwywvynwyf{nzxxhfgnnhzezexvniveifx{higfivjwyzlvwnj{kwjfvn{gxggylw{exkiekiev{yfjv{w{jwhkkxfzhgz{wgmfkvjgzizmwy{wnjggkezkm{hyleiwyhm{iie{ngzzwvfkeexkehkkgnh{n{jgg{i{egm{hyyfewn{ifizvyjemzzezw{gkzzzyywhgnjkizxfmyngikixwfkzxhmznfkkegz{e{kkmwjwnm{wfnjgi{{nljix{igjvnnekw{mwjgixkg{ky{kmfimjhkgxv{wlmnwjmh{kxjhiivvhexhmzjv{mwhkyfevfkhgfe{lfzvfxyfkjmmhyhvj{k{ivyzlwhgi{{ez{yzhwlwhwy{xmlzwiewwmhkgmfwnjkhzyj{z{yyy{x{ngvxfkg{whvwymfnw{zfeemiv{fzy{vfiyhiiixkkyj{jvlmjeejkvyxjvl{whgzfjk{weegzwwggxjvyizxykgnnzn{ynhnjkmywhxv{wy{ynyzjkkjinjfmkkignnfinj{knhnwjiekzh{mnlwjvlmnnlkenfjxvnmfyhfxzz{fynmfn{izfgeezwzzhggvznnlgevn{khkhixwvnjkyyjvzj{iig{w{vjxzwwleizlvfkimw{jw{zv{zyh{wm{ee{miegmjggmhmjzgkmnigwlnhxnmhxw{vxjwyxffm{z{zhmwhwyivfxfk{wgx{hmlyl{yggegxwvwgv{xzyeveivnkmn{xnvh{wzffzfvhivnvljvjxizevgz{jhz{e{y{vhxgm{wmn{evngvgknlvnnjfx{lyhvfz{ixjmekkkgkezxhzlxlz{vn{veiwhkkywwj{vixvjxjjkxjhxwfwjixnhnyfgwnkkeggm{hwf{fggeenyyjznzhxhfehvgk{kgizzmhmneggzmwjxmwwwjihkeiivfmw{zlgixfvyylwlkinf{{zvfv{lnwnjz{zvix{nn{mlkm{nimezxnkeeimnx{jevnfgyhmjieggvjjeevyjyy{l{kmlvfnnemfeyneeyfmnyyezfizyxyjzvlxl{knjvhhgmwwwjmhe{jjv{ngmemhimjnnjmxjjgeexyix{imjmfnjfekmzfxhzyzvx{ylfxegy{jxhen{xwmhw{vnywxw{nhxivfijxvhvffmmhznexz{{w{mfmwfhehxfvwjjizzkizyyjegjkkm{nge{nnhegxwee{exhfmegznzn{jnwekhmvljvjgfi{nyyzjyykiwyvj{j{{{nxl{yvnxwmljiznhvnlz{{hwjzyxlvygi{{{zixkewwkifveezvjejkzzgx{nzxgghxyj{wx{whyhgzxwvl{ewf{xw{hefvkmji{{ieegw{zn{kfxizzfhejenjhxvwvnnlyngvhzmjz{zhyf{mjekgx{{lkmynhxjiivm{m{fv{h{ivnnnyyyyhi{zxyjiyfvww{mjemmjhkfkkgwwx{fifgx{mfgeynjx{jnliexh{xjvnn{yjgwjm{{f{heeie{hnwix{{egjgkggizwimny{nzh{yvwzfjeemxnxwje{{hxfvy{emjk{nmnyygezwfmwyhzynwnhkvfjefzkeny{vmhev{mevn{iijgvywnfkzyxnnnyfm{jkjvke{hzl{x{yigmfhvy{{fmygxzlwwzjwnivhkmhfmjzwjvywwzwynnfjkzxzjjivjwnznhihkwjwy{egg{x{nikvyigywv{zhwyievwxjyjn{z{xyzlzvggvwzzfzzwimylzj{ejkmlkkmlmjixkeeknhemfgigvfvj{yezyfiihkyfvwjiki{kevvj{liegev{{lxyfxhm{y{myjyyz{z{eijx{{v{fkkgmjmhhz{xzxjxvjikemexhmvwgifehkjgggikvyzn{ygz{gz{hkhiikegmwnl{l{zwhy{gznwiivniemjkmnyhg{jx{{ykevw{lzjynnnyyhmwyfgzhxhwngvhiml{zxwvhynm{{nnleez{wyimkievgi{yemmhgk{gfmm{yhyljg{fevkmgiex{wfzz{zyfzvhjxfmzh{{{k{wixv{ylznnj{lhxek{ffgkmvwzhjgkgn{zjjiznzjvjgi{zgzwfwjjmkixh{nizgzvfwhizzjivzzmjyfezjzxyxjxym{gzywhmxjynwwxhjg{vwwizwfhkfkmnhmjkzfmlfgekgmgz{ewwjivyeg{zv{mnev{ijmvhy{ynylzvkgkifiimiinhxwvhvlzhwyjmvwyyzhmyixvw{jezegemwyx{nfwfzxxwjimniiw{emnhwhwnx{emwwnf{j{whxhghxv{xngzvy{yylxwmlnwjvfgfvylwjn{xlzhzwjmzyxlfvmymhjmmyhxhzfghmjkmn{mzzxfwlfxmnfkjx{eml{emhyfvhwn{lmjiexfv{vnimem{fwwfvm{vhfk{ljvhizvignj{limezxfgkevfzzjevivvffgfkzhvjgzkixwvwmfx{{i{lxhwjkkzlgeznjgkgzzjeemkgjz{veeezgvkeezm{hkzz{gvnznnyzwwffzjkgxmjevxjgvfgjzkkjm{ihixfywhvkkexjzhmkknyvhwn{efxiv{{hemy{fjziex{xj{wv{ggegnj{evy{mw{z{vyzw{{vfhknfivwfzyekvywwmlv{fzyjzxnhjxhznwnyggn{vnizzjjifkjgzh{nxfhkhvnj{ez{gkemn{fgnjhvjvvhwwfmkghiyyekmwnjzfzn{zxlny{eyhfvfizyixzzfvhg{keexn{zzw{xynzfnh{vm{fmxfizyhv{kekevwexvhekkgxnyfkgjmhz{x{xyjeiikiifghx{e{ez{hv{wwjv{zlzjhkvfvlvwfikmgvmlzlvnkege{y{xjkzzhvwfmlwwjzkm{{wn{ijznykmeefzkmgxemkijizyynynekjxmf{jzwekeiemkkvwny{nkmzjgvnngxkggxmjxhzjvhwnnyvlvwywynfexjxfwhkijifkgmxlwwiiexgmnnkeyjgiyhgekiwwgxiimyevjizlnjmlyjzvzhezixzjjgmwjikghkzxzyeehggmww{xwyjzwfwhhgzyvhnnxjigievjixznzyggfxkewjvnnyim{fnlyljvgzemkk{iex{j{xwjhekezvhi{nx{yjwlw{jgylgxigxlgejegvjx{fvw{lmhjmgzzzjv{yzwkennmhik{wmlyhxfwn{ifkxhzlfznyyfyhmljejm{lgkyjhzvlylxjxyhvikjihvgixyhvzjgekk{jyj{xgznjjiyjzxvhvjvnfzexizgxv{{w{{kkvwxj{egvee{vznnhezmjnhxjfewlfgjghzxligmym{{fnj{xjzmfeezf{nyf{g{fzyfgznvwfkgx{vynkg{hvyfeevjezlji{iwyxfwnvf{gnngmhi{kmjizwf{egehxwyxfnnzzfxnyfxhvkgznvjizvhgvw{ikwhvfvlnynnhgz{gkvnwh{lzwvf{xnfwl{evfzhjiwfek{mieieee{{zfhk{hwfzhnygvzzemkenjxnge{vimwhfkzlim{ywnxyvnggimvfjkgxhkvffm{fxlyhkikk{mjexjvyxjxym{hvzyhxgv{ghkxwfvemzz{mgejmywyhjgiizyfiexmf{gzymlmjn{egfiyyxfke{whizxvjgg{enffkeehvxn{j{ygm{jnnnhnfnwvwgk{yxjjgjvm{hvzfkmgmjmgkezzwgvnln{{geifi{ivnn{jmxjzlivylvjynmf{xzzw{w{zj{kvjnlmlkkfxienlnf{wimy{{fxnvlzhnyjezz{wnjwwz{fkizvnzvzy{hkggxn{zljvfxxhigvwxlfgiixh{izhje{whegzhgfzfxnnwnwwji{nzym{fvz{fezvjxmhnwmhjijmiizhimyhkgemik{{{ikiyn{{{mvlig{{zjmwzlfevw{lzyekzhhzzv{gvwnnxhkifgnhnjekekyhimw{{njzvnzh{zznkgiexynykmjifgwj{xz{njfzjzhmml{weijkegegfgmn{myyjz{ezhzjkgzhgxyjgiznxnjix{jex{xhgexlvjhkezvfgxjmiximjvz{ee{hnhkmwymlex{gmhw{jxjkgezjyh{nkgvjv{kekgjxyfjvwwkmiekizzkmnyfkyhyhxjivnnylfmjegizneiikjmfk{znheiwwjiyn{hwhmh{wn{kmkgyjfkxwz{zjxlnwggxyfivjwhvnznggnjxlz{hviihkfg{zzlegvwfeynv{zxgeyhjxwyxym{{fmhwygk{ew{wwkmjznhexm{wyvyxf{fjzxhwlznzxnfwnnyievnkehxkimw{xxfmnhxznn{n{zyzwjigzfmwffzxfjmnfznvnyfex{ngk{whzeegggkixevhxyyixggeiieexywemgxynzhxw{hjxgvvl{vhxegmfgmjzeiwfhmyfnjmlkexyzjkmynemkezhhzxhznmfvnyfhijvxlyj{hynegyjevwj{wylvnhmw{evmhgzyhv{gmzljiwjgmyh{nfggvmnwnfzvffzikmnzwjxvyvyizjk{f{wzhizyhvjhxyjyyjzywfm{yimwjkiyfmfnywlzwzwvjezig{ivfkemh{j{yxhkkjehvxyjz{fmlfkgixyynjijgywzfvnvfzyhvwnmlvywwy{{n{kfzgi{vkkiiizyfjkwwkmgzgxnhkgw{keggylegzvxyjvev{xw{nnigmyv{{iwhjmivwwgz{kynmfjzww{hnhggzhkmkkyjvfvjzymn{nfizh{jxlyfekxjmjwy{fkgmfwyxw{xgeexgihzwfnfznjvn{kkmnvw{izxzziz{leekk{vvlnyvj{lyhkgjgkkji{vzwmnhkmnnlgihgfvmhfxke{lylvhkm{gxlyfemxnm{fkylfkzhfmimgzfgxjggmljewwwfgxgkxjjifvnyfgez{njvwwzvvlvh{wkmxlnfx{exz{fk{fhkx{{nzlmnnfjxgvvwvhfzikyjjgvnznzwylmyzxnhfxwh{jkm{nimfv{jmnz{mnhzw{hxggvnkgivkgnh{vkmhxjefgkmzjjxeekiwwfm{zyhgijxke{zwljiw{ivhexl{mz{fkxnzwggzl{ymffkkghxnlkmnfezwlmlfi{igejmfefkwjfzn{kinh{hhewwezvljgnhxjzz{eiixn{y{fmwnhggiv{hhkyhnnii{mynwjvnyh{xv{mw{xvjiiixyngimw{fw{jzemwfvhjxmleg{xyhfifeyhfzylxnkkjznhkgzj{l{fekvyiiyl{gjgjmezywiznjvyzyyw{g{xz{nwy{ekgxfxeifk{lexhknnyhy{gzzw{jemwyhgmhevnjhk{kmlylfgvyzw{nfe{nv{egzyvlgmmyxlee{eyfyfkikm{wjefmyffzylzngvkiex{{gvjmz{jkmfkg{nkekgwyyfxfz{nwhxnlmywlev{zz{geimgkynvhjez{xlizfv{ywwkehgn{jefgzhyw{ynhjvynivzzvjwhmnfm{f{jjgvj{xevikmj{fzfnjmfxffizfzfnweiivzwznegeijghekizyivny{hvwezv{{megwlez{nyh{nekmhezizimvnwj{zxngm{zxn{y{zhgivkkkkji{khvmwyfvwvljvnfvhgmyyxy{zimzxhvmfyfeegizwhi{h{mezgvxngimyzfvf{xnjvyzjgzhezw{vheyfv{zhwnhezfkimyvjgxynhizxjehvnhivvnem{{izfeexexz{imgzynvlzhwjxyhkny{xkigmvlzjgzjggvvfwfjmhxgkxlwnmjgz{f{xeeee{zhmjxzy{zvliivwnygx{yevyw{wxf{ew{vhjejzyj{jfivfik{gmyfgjgxjjzjvggwh{jvhfmjgnnwwzjywhzfvgkjkfgfxjeyykiznjzyhgmjievgk{z{feeiz{gvlhgfxem{lzy{ev{yhmnwyjzvfz{eizlzffm{mzxgiezzfzhkkfgxjimn{vyww{imjgznw{fzlx{{wyyyfzyhv{nekivw{jz{ln{nyzhvnkgnfiijmvnkkv{zhjzfvhgxwjmhi{gw{xljv{ghvnnhvwwwhxjvygxxw{j{vezeeznfz{ehivhjinlhgjemhixiefiixkkggjewffm{hxnjxmlhgvnimnyy{vwmyikzfgzynwfikexjexh{lfvfxhgfgxlxnzfvfy{fghxzlvwgkgg{zz{nykewfkmjezxww{{vnzhfmgvkeww{xhgyyjvjg{{ylem{kig{jfkmyjgjzmf{{{xfenn{k{ijmjxzljgjkjekmzjjmexjeheegjzjixyfxfeemynkmmligzlgvzlvyw{ekmykknhzjkigkfmhimh{yxj{ykmixzfzvmwjxmn{lfzekvlikv{hkeiwyfkwhjiywmfxywnjixn{kz{wn{xgzxnjgwjggvnzligjevnvfxynyzwikzynyixjmxhivwfiehvzfzxyjgggznhyyzf{{{xjgfxhxkinlnweewh{fywfvzv{f{{{i{fzz{izhnw{k{nzlhvxjfeyfywzfwjzxvnvfvjw{xhx{gvynxwhihxxj{vyhemfmhzhxevmhvjzyhv{{mnfivhkg{{fmmlylz{w{zyevfmgxxhzj{nmnwlzzwhkmz{vjhi{{imfz{gvwnyvfnwzh{mxhexzyvnje{ejkylkgznjgznzxkkemfkzyjifvzwizfemwvw{yjevhikgkzykmzxfkynkifzkiynnf{jwnyhigevxyjigvvhge{zvnikwhhegkfvjzzxwhzlex{mggvfhxik{inhjkvjzleiemfghegkwwwyjzzv{nw{zyzlemzjm{y{zzzxnykeimgvzxhkjkx{wnezzhjvxfjzjm{x{vylzyhxegfm{hexvhggvlhzzyikfiwyhknyvwevzzgvhkxjmyzh{vheeekm{hmfmhjg{fmwjxmnxykgzlxwkizyxyfxemzngzzwfgfe{w{gx{gzemzh{jvlhenfynvfexzfzyggxjmhzywwfvnnz{w{jgiewj{znfnheevnmwy{fgwfkmyhvnwlgejxgmzxxyjmwjhizzigvw{yvhnfwjxfgiwlzwfefgyhkmm{fvwhfgeiixzxywnfnhmw{jnygey{ii{ngziemjzxmjivfzexfijxkizjfenhkiizzly{ikwjgvzlynjmzzxfzhnjvlkgwwnfjgxjvyeivhmymhvwegimmwhv{ekevfjzzh{f{jyn{kwf{kyhxhgmn{yyvjv{km{h{exjixhmjmfknjvjhgjgvnww{xjmgxhvzvzzfgken{ivvj{heegv{fn{ylexhxnyzfvy{z{i{zwyie{zhmnh{k{j{ynlmnnjwf{nnl{eyhywn{kkzvjzzym{xffgzwheyfzyzxfgjiwyevxyfezxxlmy{iwyzzii{xzyekgxkezlyfgijeevkg{mvn{lwy{ynw{vxhkiggivwjjkhz{h{evhfmvhexfigkiz{jyngmnnznnjfx{gjznlvf{kkgwh{wvhivxhkiz{jevwmnjkznnwxn{gm{{j{xjixhxj{ywhfexhzznnzhegvyynv{iifxjxjgn{xl{lgv{vgv{ykmzjgv{yjghxvwhziixjwh{njm{mwlkimjjv{lwneegvzyyjzznw{heihefzzzzx{jjxm{x{izikm{{{vjivwynwfvnfxj{vvheg{ljvnwemzlzhnlevimjiemxfnywjgm{mzzzn{ehvkghxyfigezxwiewhzxzx{zexjvmwxlyl{mzvkgxfnj{y{wxwz{jzmjxhnyigie{h{m{vikeijivhzljeyyjm{yxjzwhkhvxyzhnyjmiviixykefewfnlwnigggvyv{mlwyyhnygzgmzwnwmhezvwfvevgkz{gggkzjvwfzvyevwwnhevfkzzmwegzwznjg{vhxnffznwji{zz{wnwwzlkmkigk{jfgjgjihzgzmnjgjijvzwfzgm{gznjmzfggzjjezjkghew{wfvfii{hfgzlvnexjixfkmxn{jnnfiwnekmnivzfhevh{efk{iwlgzivw{kgzhnlivzf{fm{jgfifeyjgihmemvhx{nlznywfexyvffzzhfeizzwwyxlzvfifmfzzlhk{gjk{jemivzvjkmyyjfeivfejevfjkyneeny{efkizhkikiknf{ngx{jfvhmz{zxzlnlznjxxnjg{vvwnl{j{xkeyfzwjxyfkg{mkkjeezxy{wyy{neiyffzzhznyfkkhikmjveiv{wyn{z{zyvnkm{wjkv{{hixxyx{wjvnvykgz{hxn{vhz{{{ex{{gzgxvnfxvhvwvnjxxyfkgivwzzjgemgeywiex{wh{zny{e{{{vgeevywmy{kgzzlwhjvvlfvxl{lnl{wyyzzxlixv{zvgghxxhzznwzhmjyfzvz{ezv{zjzyywjmznixzhvjvl{yjk{eyjmjgxjxgzgmyhgk{vhvmfwh{memkgfezwegeggkm{wwjewn{n{{kikinh{fjvmfnlkkxhznezgkevjviimlywmhnfiexf{yyhjxyjjxhmge{jimhin{{zvfvwnfem{nwf{gzxnnyjfiizfkiiyynwmwxhnyhvhi{eekivekzxjexlvlgvzn{nywfxzy{gv{mlz{ke{xgvnljz{ffmemjkegxwzlyyvfhmgzjmyfjvnw{lxliinjmjfzkm{fiiwnwwikigfigxixwnzwxnhkw{y{{lfivhevwyevjzgiwhjx{fwh{wzwkigg{j{izhjzmfzyznkmvljgmfyjkkyyexvwiimyxjjejzjgnljvyyiv{gvf{j{fn{gxvnzzx{jm{{nnimgi{{hkhzzwhgjxz{z{heyhzlzhywn{yjyj{ggxigwyimwhxh{{hz{hizez{v{hxfkkzhevwjvjmhwnie{hfzgk{{jgixnjhzji{hnlyjzhigzzevemhkn{ikz{{ezhzw{{fzzxvj{mmjjivhekhgvnz{mfgzexzhfehxegkihgxwekwnzlgxyhxyjgggzhzn{gkk{mxwek{whgjvfxjvvy{{z{zxxyjemjhewhimzwzhnhmhemzyhkwwzjjezz{hfivffivhwf{hxlkkxlzf{xhzekei{ikmkevhevfgfgnwjgmwfmxlfmkieveimfevzykmzffkwjzwgmyfvnvw{fjz{{jmfznhfmzxzzyhzhxjfvxweejeigvhwjwnfgkgzjyhwf{gmnfvkkzz{lwfeeyy{gmwznhxnygkjvjm{hnyjk{{jvvhkgjk{wievhimikjxvnieyfgxznwfnyyjekn{njxfgvzyjz{fgg{ykkywge{nv{zhmjkmzwyfmffvzj{lylzf{wimjmggfgnykiexmwjeevzy{wgzjzwnnngzvfexwwzyhxikgmfzzfxy{vnnixhvekhgixiznf{wzyhewynfizfmwn{vxwvyxfxw{fynhi{xzvyhnhzykizy{xekylnlyyfk{jnjnyywjvfmxnhgeekkzw{yynfvgxkikmgzw{imkk{n{hyn{vhimlyfnjzlhgeiznvhxfkmikvhxynljikgge{fgvhgmnznzvwnfvynvlgxvhzl{vylgegkjmkmkehk{hixizyyx{jgyfeizwemwnfvixynkgywkmmf{j{yzjjvev{z{yixwhhzfmyfji{w{vgkjz{wivx{wnfgfvy{n{zffkznzwn{m{fkwwgzmhieylvlnlz{vf{v{z{{xf{giznfyf{vjvjen{njzxfeyfyyznyfggvn{ezhxfezxyy{{jkmwlnfvfywyhki{yfzvfhkfxikmjhxzyxwegex{mjiwnz{vnfizzhihxxy{zvn{fy{{vyweefigghkjmwykixyexjxig{iizgxmynwnyzvmywhzlkejvxjfmzx{kmnnnkkwlegemjkxyhey{nwyhki{xwfn{exzwzwwhmnjemhgvekzxjgmj{ehzmjxfzh{fig{xwnivnnjiyykewfvwfzy{gvievnkmyygiixwnexw{jk{givjehv{gjvhmnlm{{mw{izjkhxfmn{fxhgvlkmizwwyngvm{xy{injwl{wmlnwegw{{fyhzwhmexw{{zwnwnevjkkgjx{wfzzxfzfejkyw{mhvzxywjeimimv{zywwvfvhnynyzwyyjkhmnnzz{hjigzn{nwzyfi{zw{gz{knnwlnwwyein{fvxfmlfgjmgk{vgvegyfexzxhgzxie{ezv{{jikmn{{yyfee{vywx{vljvmhhgigeeyygefi{vgkyyjeeewlimhxggfv{e{jjggxmjjvz{zviemyekxhnlnfnnny{jjmjzzwez{iy{jxegivv{zynjn{ezhkjiizfghgkgfggg{fnn{hyj{nzh{fx{ggnjhkfmwjn{zfv{mfwfhxyfvyeivwii{vjgmhynhzvyfmyyzjxjvfki{ww{vjfzjxvyzyfzgkz{mljzjximjixlzwxhkejejigezlyyjmyniezhmy{kmy{xexzfeewjezjv{whvgijgkg{ngzvwn{y{v{zlvj{zizigvlhv{fhvxfvyfeeex{iijg{feximjiem{mnjfexfmjmwkizw{likizfk{nkghx{zjkigkm{x{xwn{{xygxzxjijxkimfv{mh{gy{geyl{nynmlzxnyhkieyhvwhv{xnlzhxw{yxnemylikxjgm{j{whmn{kmnnmjwfv{yjfmyh{n{hixhizn{g{nx{zxxlzxxw{gnfjkmn{mzynwikjemwxjfk{hji{fjk{hhkzvhehvzhvh{wkgjkwyznigv{{xnfjejmhiiexhnykghiiivyiv{z{vikzzjkwjvnywfmkixynhvwfmzvkezz{nwjw{ezhvjg{jmlzywfizv{{e{iy{nhkkx{znjggm{gywwnjgvnzfxfivhvyleev{{w{wekkkivnym{{jfkhvhzw{mw{hjiiiei{ljkvwxjzz{ywwvyjgjeemz{hvvlnlhejghkgkyligwffkjznhvjxf{{zw{l{gwnxjjiwhvlevmyyfmfhmiz{zjmezzfkikivlkeje{liegzylxjjkwwixkgznzl{xxfhxgvwjwn{hiz{gfxznnfhmvfzyekjgw{{hzwekjmzjhgzxzln{v{kkyh{ewfkmmwzxjizwxjzwfkheyjwj{zyjvwnjfk{mjiz{nlheeex{{zvnhmyhxlznjvyh{ewhhgxfkijgzneijxmy{knw{v{fgzggy{nhmnzxggz{yjzlxngikmvyjgxlzngvfkevnjnnfxfejzfeje{w{ky{zn{ymhggfxm{fxjxkmkimj{gwnhzjmvwvnnwjgeeivjkxfzv{vmygi{yzlvnzvxjy{jkggxw{ejvjggvzzgmxlyyjemyzlvlhkfgnyjkjeivm{nwmlylw{iiynz{{ifmnlvfjzmlzwemjv{nnyjkvlzwiizlvhmhfgwweg{xzfjkwhjmekjzxfyfnn{xnfyfwwnjwheky{yj{ejgmljimyvfzhhzgvwjmhezyw{izyvyzhjmexixnlzymh{fvhhzjvyhmjyyevx{wwy{kiy{ik{{hmhenfxlnhynnyyl{xv{{kzvvy{hjkixyhizml{g{yx{n{{zhxznzhw{{ejijiv{xyhmfzjm{ymnz{egiihigvfkywvlik{v{xyyjizhhkvyfinlhvvhvjexgewhhvhzzxeimfvlexiiznhv{j{n{fkimyjzginnjmhgzjnjnhkkzfgvvhvhjvgvzyzwjgyjzwxlhehzvwkg{l{xkmxhmfny{vzn{wzwjmyhixfvhijmivxwwnzjkivw{wyfwhzwvwmfgzhvfvxjemfmeknjhkvhzlekmwywimheeg{yvleege{vwy{hfi{lnjn{zf{fjenl{wmfgvzlhggx{g{jzwmhwhekegzlwlfggmiz{xexhg{{zjigkejkzjhiy{yhjkxyeenjynkmmfxnvhy{zzgzjxgkex{ziifgzyeifvggmlkk{z{niekgzvmjnh{im{mwevxyke{y{vjg{eeinj{ghiv{izxlmjkggxy{{izjemzhwlvh{lnj{jmlxnxjynizexnwn{zlmhnjzwwy{xfiexhkjihgmhezjmwjikgmeevlmfhzgg{nkg{{ezw{{ffx{nwf{xzyxlxwfkmnfxzfzhxfivimjknyfgekzfikvjnhig{mznfieefzzxzfkev{vwiegggzylgkxfvfxlyyjeikeiwywjvhwwyljgywz{nnzjizyhnwx{yyxhnjik{{gmvlzfynxjgv{mvnhzjx{lhg{g{zvl{wnyyhwyywn{{xvwzymwyhnw{zvyhefkjkxjhiynynfvjkmhmlmlnhxwhvhz{zjgivizizgg{fivx{ezn{{kjvnwznezig{vvnzlexzviiezv{wnyww{vw{n{zv{jknykiemkmzv{jizzngmyjzngvnl{gjvmjemkkyh{{ywgxm{jk{mfxeivlnngggmgmvjhzkgjvzvyfxyvhexn{mwzhvhywiivjimgifmeghzhgvlhmvnhmvn{emljegiii{hwnfmv{gihvwfkm{fhvfkw{hzjzje{yje{ihz{vhxikfexjjmzhfzkmww{znnmhmjjx{jmn{lmjhg{fjemffihvw{wwzvjkhiyn{{zvixezhvvleehkyyznzjmlyffkikzhikkk{mm{hxwnggvywhn{vhyjkm{njmjvwyhefznjeizwegmfmnm{fxzlvwzlizfmnlfmkegzwfjx{lhxikvwzz{j{lmwz{wnzh{ivfevjehkizjgfmwjnjfkimjzhmmwyyfmmlekwhjezzfgzwynfkiewnkizjfkhggxkekihmxfmhm{n{ggkeyjvw{jkeyyylzyzvmfnlyw{kkg{mmj{ekkgxy{yw{mhkwyiez{jzgxvjhvkm{{nhhzegmlyf{ymn{{ivzwvhivhgywzwemmhgmkghmnfezxhmyeeznzjvfkigxeg{nw{hxexfvjxfx{wzwgezhjxnwwjhmwhegmnjeig{{evgkki{n{weiwwzffenjizyfkejvvymf{hyjezwfkkjgkeixfekgn{givlgvjejmigjzvw{vivjigvhvmjiexl{jeeii{jmywnmw{lml{jjzkg{kvh{xjzwymh{jgxzw{nzvzyezvnmfiekeeifm{kznfznfywzxieyjmjixwfhkjxggzhemzfnnnlgkhzzlyyyhkeexyyjzimjgw{wyz{nfivfv{gwnmnzvznjmyhhekkvnmfekvffehk{iynnl{gjz{h{fv{myjikiynjgxlyh{g{en{wfyjzzynizjzwykmfvnjhz{wevmjmw{{hkje{k{jfg{xwnmwfmvnzlylwnikzjvhnw{jnlfivfgixhvyekgmjenlzjzlfkxhgxgkhevfwjzyfe{i{mkg{wzz{i{keivjhejxxwvwekkgzlgmwwxfm{zfemmlzyvjvhix{gxnnjnhhmmj{{hevhhzvffkjmkimlevzywlhizfhvhxyl{ngkkijvwwyyhvyneekgyyfimhikkegv{lnnwwjijg{gfm{ijiznznvhzv{e{{ywjx{zwfeixnyf{jyw{j{wkiywwwevyngxmfixzvjmkeynzhxjgmwjfzw{yfynfxez{fxfvlegznmyyy{fnn{nexjgznylgmikvwkg{njefezfmn{zkehxxhnngi{wjinlnfjkgehvjizhjznhzykkmny{x{{z{hznzhmfzwhexfkizhhzxhgzfxvfyfjmyf{mhg{heegkmnv{exegfmywxhnfwlgiyf{gwwfvjvylhk{eez{fjgzwzvvfjgxwwhxhkew{mfhk{ievfijvjvmnjm{ev{x{ivegji{fzyzhigvwkexfnfzlwwfznhzjwjkky{fvwjegmlkkyy{wnlyjhx{{{nekzjnwwhvlvyvjimfewffgzyfzwheivliikemlgxfmzfxhfmmlwfnjw{{ekigvwfjxmw{jmhzxzxnlm{xnwfeimhjkeejmmjxygewn{knwggig{eznkehxgmnwmwmhjz{vynvhzlhvzyzwzfhm{ikgnyeg{iyhyhxnnyzzkigziievmwevhgz{xn{kixggnw{xzwvyny{zhx{vxj{hjz{g{xmh{wim{xfz{fxjn{n{ny{n{hjkhezjnhyf{w{nhmgkywzwgggvhk{e{ymyeejehgxhzfvyxfzzezv{xy{{vhnwfgfkzf{lmjylfzgmgm{jeegen{gzgxyjeghewfkmwnhvnhnnhvjv{xikwjmfvljgwygziv{ixhzligz{kkzfzfmlzy{nzy{xw{{e{gzjm{jzmngzvligzlfgfkxhvygz{f{xhvikeejvjigem{gkyfzywyxf{vheee{vww{{{lgzgkivwnmlje{e{jxyjv{yjigmwwzfemnl{l{mmj{jemznzfwlmlxywyxnzx{lixnhnjgiggvjexyf{gvfje{zzheevnyf{hjkwhylfvvyyln{{igxxnznixjkwywn{khg{ygkzjkgxj{ixwjxeiiefxwhnymnemyfkegekeylem{lkkeieemwx{nnvhivjmvw{v{zzx{wn{{nny{migvfzlgznyfzv{{mikyymjjxxhnhiivyhiyw{wgzyfezhgxhwjigfmgxwnylfzxwmh{zjxfzggyfkgfgmyvfjvfmivx{zyzhkgyfzw{mgikkx{hgyy{xkmnnvjfi{nwyy{hzhzivkgjmex{fjgyhxlizfgznmjyfexgvgzw{vn{ykknynfjkyfmlfgynimfevlhvzxvwexzngievmfgizvkkw{he{z{{whnjzh{kyfhkvhgvmw{jmhjmhemh{vjgw{ixjxkinnhg{evygewnmygvggezegfzmjivei{hvnimikxwje{zzxfinnynexezvwwwhz{mgvhvxjzhgkhxnhfvjenhvwxlv{yl{yemvnkmighzw{fmzz{lfehz{lzvjkx{vljgjkgxie{j{hzwnfzjyn{nnhjznyexzvz{mlm{xlgxivfkzfx{wjxyjejejmivvl{xzn{v{gxfvwwnggfgjzhkgzeenwwh{vexhgww{xvfjgywzlivgmwh{yvfvyyl{{fi{w{hhvnnfgimm{zxynxlhkeimy{vxhfkwj{nhzjkzvizjxwyvlev{leexyjg{l{j{ln{jgjegvgejzjmwyy{n{vn{jhzwwzjgkivjgn{n{fvimnlnhfzzy{j{kvhwfxfw{xnivzvzjggjzmlkm{xginjnwvfhm{e{lzyeifzmlzzzjvw{mhxmfgizwmhimhxiezyzlwhjxegezxfnjnhxjnnjieznfxyfmfkvjwhvniemhmheekevhjezhexxnnwww{zvyzy{wmwevzlm{{lkmhemwylvhzvnhmwwnmwjixjfvigzh{ejkzzznigmwwniiznzhmfhxwfy{wfxyhkimgznymwjv{nxjii{jivvwyfjg{yhxzj{wwwywn{jvynfxvfkkgzwwfzyyw{w{nnzh{nn{igfi{{zxv{wjzwwf{lfgjvwwm{{xixvyzvhvhgz{xhivxnimnlwlvlxfkg{w{xjmfvvfnw{g{gzfmn{mzhkgekixvnnfvh{nywfehiemixginwfmvyezigjixfimfeiknlgikgkmgmiigxwfvjzxzzwh{e{y{zyfzwiijxjinjfiznnn{e{ijin{jkwf{{{zfvyf{zfxhvwwhzjxnwhmyjml{lixzjzwfemfyffzmyizyjigxwjgignyvnynhmzvjgw{hgvyjkjeyn{ggk{wevyhyjhkxny{wyhexj{fjijkhvnh{wyjwfmlzz{xxhfvxfzvwnmjzwvymy{xkg{enhm{gejzgkeezjml{hvngiivxywwnhegyfkifx{zhximmjfzivynivfk{vimhekkfzzxizzzgmyjeviknl{{kezzv{gkjgwnhe{gjggevj{nzlz{xf{ekk{fxlvlhiexgmvjxhgezhgieziinhmjzvfz{jfezywfnjxn{gm{zwjkxlieyhzjgghxxhfgiikmgikiww{yhvwwzn{zikmhzhgvnwheivx{wlmffimlyffghxhkeejkfehmnffx{vzxwjznvhyyzz{{mnwwznmh{wxnznhewn{zyfjgjmgxgmjx{y{jxneix{mlezhijzeximexhxienn{n{nnfgkgxiviv{xvwgkjeiveiyyjxgkekzvhx{yhxzlxwzzzhznwlhxhzjmgi{wyyjmwjzz{zjzjknnmffkjx{ezfnfhm{kzlylnymfzwkg{wwnxjjxvfyw{wmhhimjhigvhkylxlhkiv{{ik{gwwvyxygiwygvwny{kix{{jjxwj{evhivfxfkfgzlvnfk{yhe{gylv{vnwl{ffejv{xixnhkkfehzylnf{fmwgm{fkgwnvw{eikjewfjgjx{kwn{v{ljkkeynmnmfwywyhvx{zwgmkiivvnnfx{zzkizfjxzn{fy{imvlgm{vfkwn{ykg{zggjziewwjgx{hxjenfyfhvjxzvwl{izfw{iiee{gekzym{wnvjzvevyhv{{jgkfgywjzxhyyv{wjvnwjmn{whzhejvhzhg{yxn{hxnvfezvh{fyyhgeixfexvffekkvfeznfeegimlfkhekem{ixgg{y{vjgzy{l{zhx{vxhkmgkgv{xmh{wigzvfzjv{yz{n{ny{nhk{zhezjxlyyzn{jhmgkxhgzexemyfxhxhjvkevf{vyjgvny{izzezwhy{vfvhgxjvevvn{lnjylfzgmgmeveegen{gzzykmgkfmzjwhwlfiee{nhe{zkieeizivywyhwlgm{gikigvljijevhx{zhyn{nnjfgkevfxfzjez{zemz{zvjgyyy{fgfkxhfezz{xfivn{z{njvjigem{gkynz{wyxf{vhemhjixjzfkegiwhzzxyhxzfwyhizvfeimwy{mvfnlhmixgkynzxzhfmwwivivjinjfxkkzxxyvjnfzwfeemhv{eeez{gxmwmlvffvixylnfeievv{ezfzy{emmh{jeewhfk{xwwevznylzfxlgeiehxzlxww{hiznwl{w{{{eevizxfwfzjhe{v{ygg{{jkkmm{nneex{yhmy{x{g{nkehzexzjzjnyzy{whxgm{gvjzwml{nkgvnylgzieekeg{eizwhzzw{wynfznylfefxkixfyjgmgm{keexfn{kkfzgejxgmnyhxny{yeekkezz{fvmnznhejimn{hezvj{fywivgifkjkjezxzhmymhnjex{gyhemkkggyhwfx{ggywn{jm{wfennmnkifmjzvfnlzlwfzlnfvfkihmyhnwn{vwmjjkwwgxekgigmkmywjkzxjxwwnhw{mlwjwn{ejmzzkmwyn{zlkivhekgxjzgxv{mwfinhiigkxjjeevkmhgjmzyjxynxnmygevnegexm{xwfehzjvgm{xjzznmnnfxn{ekgmjgznnyfezhkfgimyh{kikgkemnhjxvjnjjxx{{egvfzfzjkee{gwwm{n{fg{nynwhikhz{fimhxnjmfylzwhxfe{{higmyn{igxxjhgzzmfxfjgmfv{iv{nm{nnwlywyw{hkeegggmnwyvymnylfzzvy{izzyy{{ywhkkjkjkjkkkz{wnhvnhvlwfyj{eiknhnlyw{lvwiiivmyimnyexvfiexj{mywnhfiwwzj{wzjkmn{{imhjmmyizfk{exwfvfmggiigkvwjxyw{ljmzyzlnwmfkihmixkkwwxhjgwliigxek{zixkmywjkvl{kyfzwzlzlem{zmhwyxl{{njhgm{wf{emfkmv{hgxffxjkw{imgzhinjzffxy{kiiezwnjmwxyggvwfgikhixywfzl{vylvfyfkeievfzjwweiwwhxy{mfvfeigikiyl{mjewnhihknlfiyf{knlzy{jjk{exfzfn{fkkijizznfhxnyy{zvgg{vgzjekigxhehzixikvnylwfkgnlzw{hkmxjhziemjnhxwfgnyy{zfwwyffkzyn{fvmwwnexmwevnyevzzfmjxfgmnhxzlexzxyhfxxw{ewwjv{yvy{enliiw{mfkgnlfmegnlhezj{lix{nikyym{yn{kkewwjxjzgxnnvn{fjiggkejggvzzjkkefmjvnnnhv{kkfgeigiw{iejxgvzzgghvixynwln{{kywkimlv{mwjeyw{hex{lgz{jggmjznge{lfgx{imgkjzeiwf{fgiji{lgvzxjmhz{figimxln{vj{iylkgimvyhmkg{xzln{jgjzikizzffemwxnyyxwmwmfywwjegyhfkfghkeijgnhevfehxzljknyywzn{g{nm{ynfmxfxjkkjijxzwhzvjgxji{fiijeez{hzh{yjxjv{ykenlhekmfzhikiylgivjmyx{jmiimhyfikfizzhivyemyhjiikfkggvjzvzwv{ekhkwwxynwnwy{kgzx{y{evhjmkkkgzn{gfkzhfi{lvlv{{g{hyw{fegkgzvvynhemm{igivjigkvhikzf{{fvvnjgeggiim{efknjekfvgxyyxjznxhgey{ivim{fw{ggxjnjwj{{v{fgiiyyhzhvyleeyw{h{wxjyn{lnwwhgx{jmjkiwn{nhzfvxjemkmeijzxymjzfhm{wfxvljkyh{lzxgzwhzyzhnygxvhx{ie{nfmkgie{inhm{jvgvy{nyyln{nfvfvwfvxnywjzke{mfgxykk{xwwkkiexnexnwznezzymjjzkizh{vv{kmxwzxnhkihvw{fk{wjmnyx{gz{vfgmlxjixmfmfjgxnnj{lzh{xexnjizynw{wngz{jyn{hgxxymfxjfegzmh{v{neezvylznxyvnjmmljxyleegiwwfzhm{vfigezwvyixgkvnhiegivezwj{w{fjemlkmylfinlfvzxfihgjevffk{vfmzlzlikyn{xhxgzggzynhwl{ngviikmfkekjmgzvnzwnfxffxwwevnlwhjmggynkmvyizjgfevjn{vyz{zwylylmwgmxygx{lyfwwxlxjxljkzykkjzwfzlwfvyevfg{eixfgmfzym{{ezhywzhkenffxx{keekggvnyngmzwzhmjzlnhvlhg{ifivyeeyyizyyywzl{fevikxn{lieeije{{y{zlv{ywnw{ynykivnhx{y{hgkhgxyexhxkkhex{izz{{hjenfv{y{x{xymnmlnfyfmnhizhfmm{mfgxizzww{znjkhmfmfzkievyyjm{njx{ejmwlnwfenlgkmnmjzwikggzyfxywxwfgzhxhjkwfwjvnfifmz{ywwnzhkmkgizwyexfx{wvwmjzxjezzkghgjxxhzyjvhvik{vxjhezwizwyii{nikhxzzzvzlnjnniggxvfm{{jjggvigizynhzgeyl{yywzhfege{xvwfmixzwgg{zek{niikkimjenhjihkgxvhiiixgxgiywjv{yjzx{evnw{lvwfkfeyfivvyx{fxzwzhkgxfiz{enyggfiwlgvxjvw{ijmjivfkeyjeemfkez{izekvffihmznyw{fnyjzylemjkjgyjzywyml{{{wjiegzfyy{l{nhm{iz{mj{jkmexvlzngxvjyljvgmvwm{ji{xjgnj{xfmmwyljxy{nfwhiexhhmvjhzexnhegkgwyjizfkehzhkeizvynyfhimjvhjxeg{kjeyhhvfmjezlx{ww{kkihem{evfifgfijvjvfezxzjw{wffvixke{{vlfzzjw{{lnlfknnzjhxiijgzwexezgzgifk{y{njkhziz{wmj{vfxvngizz{lizjxmy{kkey{fvhxyjgzjmfkmjnnekgixljzjiezzfnjeigxjezymjyhxhx{nfmjfgnnhkfiyjixyjw{kkjezvvh{x{wmfgm{lvlxhznemmlwjfivhemfvxwgzjvxlnlkeiivnizjiizgmmh{hnhmhegmhjghzjexnynmlzfvlkk{h{zzvmw{{{zfijmzfzhgmemigzxgzvlixzy{fievnhzmw{higxhxyvlhe{zzxmjhxzyyjjg{{zy{wnfxwjgx{{mnjmwgvhiwnxnwwjiez{yfmfzgzvhm{kixhmlnynnhimhmh{xfgx{zhhk{wny{xvfn{xy{xixfknjfm{vnyignwjxfgfgigzyvwwyxlixwyfzxywfzlhk{enhzzfximvynyfmfeeemwienyzlvngzmhm{jmggzwfznwkizj{kw{ixylmjeeyjgzzwhkjkizevekvnmjkmikvj{hwygijevngvfgfgmwgmwlyjzwynxlmnmjfknhxfzzkike{h{f{{{{vjzhznfkfmhxjkhvfxwjegzzmnfeeevhwjvnjzjximhi{kixexgkwjnwjzim{z{ixjv{zfeznneifkhzwhgehzjiimgxeehgml{zfm{hievlzvhvivfz{nkiz{fixnxfnjvfzn{vn{iexj{ffmhzz{n{hxhkjknhhvixmnzvzv{l{hyl{izvxhyfjiizigw{igezmwvhkghzm{{mmnfvyjywzhkkimxnjejkyhwwyfnhwwemfgvlki{hhggzhzjxzwfievgkiv{ymfezzjevzzfzfkgijv{x{{{zfveiexmhizegmn{wzwzhheimjmzzjkmyzlfinwzlwjkkyyevnh{m{hyyvwvnig{fw{gxvnigjgz{gkhzwnzfkixy{wigxj{nzyzvyykmzzzjyyzjekegwyxjvhznnyzjkk{ihknyzn{zwyezx{{xjzyweijm{emfiz{fnhnjfiez{yikgmzx{hkm{hw{w{zlmwnn{nyfvnfmgkivkeigizjiwf{ffejk{zxfhzev{whmjezwmnfifx{vizjgfihmzfznzx{v{{xlznjmek{wjinlfkzyezhkezgx{fvweiizixxy{jwfgzyh{{ke{lgkkmvfml{yw{evmniefe{ngxmfzwexiiny{z{{nf{{iiyniizwz{xfyffzzxzf{wylfzmfxhwfeezw{hwyzyjvwnyfnyvyjexjkewjjvhifkkgvw{yzj{lgk{zfvkixhzy{y{{iz{ynhzvfikez{{lwlzn{yfzjk{m{mzxkkxj{ykkjzvfzjnlzfggyfgmwyhkjefgjmxlegxwyfnfei{{jx{vww{{fvvhzwgv{ljxzzfvkkmhgggzwfjk{{nwgi{{njhgwwm{wyjezvjekenh{nezkkn{vyxjjxxhn{wfzlnlwlhkeixjggyjnwyfiehkwyexexexzzjiyn{{njxn{ekkgkvyjixw{lnyieiv{whihv{yxnmynhzn{xkiigzx{gmwggylekkkfzmfm{{kxjhxnfgxxnm{{hxlkg{{ekfinyfvheggikkgmlnhwn{gn{hkgxevgk{xiev{fgiezngkx{nnvnyyhky{nwii{kxwmwikevjgnlivwfimvfjkvlezmnwhz{{jkmjkjggv{xxfjmnnixxyjxeg{fmjgmzlvfkkgiixyjnh{l{mzjmyjzzvylvfzymh{fhvexxj{yjkvnyyvlml{n{fxjgzgivjimggkinyy{kevlixgivhjvznikkg{nemjkmnx{eiwfjkvlhzvfmyzxjzzxmlwwivzvyn{{fzkgvjxnvlhinwzyxy{fhzjxnnhkexmhfxggnjv{mhn{{vz{{xz{fkm{xnjx{njg{ygm{vy{hvgiimvfgxw{iixjmlvhnjigjmxn{kfeivmwjk{yhx{kzxnhgxjzfk{kzvvyzyhx{yemjvzvnween{ny{g{h{gzhvnjvkmekeekgw{ivivvfnjjxnhzv{xxjjmnwzvjgn{hghxfkzfiiekwymlki{vvhhefkjvmyiemnnjmfhzfeyn{jjzkgy{nfwfvlwh{nggkennwhyjjzxlhx{h{fzv{gy{v{kkzjexvhyhy{{mjvgkkezlwhji{njzvneewheezfjx{gevwjgm{xxwnh{{vlyhizgivnhgvyhiyfjizhyhiizlgz{ggvfz{gvy{f{wjknfjmvnvjhefekgivjifiwyheeijxxhmfwhnheigvjm{lgx{lhew{jmvj{zieezkievjvhxwjhzkiyyzfigvjwhzwx{vyv{vyexw{zwyfzzegylje{mjgvyy{{efexl{jznzn{x{lznzzjgvnzwzxmlnn{mmwzw{gjzfizv{hzx{jjzyjxfwfivyfvhzy{zmljzhgggyh{nnlznvwkgzvyyxlmyn{iiyhyhxwimhkjkiexfvwjemhmhjzigfvhgiviiwhjkevynnlfz{gfkkmynfmgewlwywhxwm{fm{jjvhgynmnynzzzwvh{hylhznf{xjijkwy{yevjenh{mzj{kfzkejznfekw{ezx{wn{mixvyjejmxwhzev{wjkixjmexjifiznwnzlzvyjvjzhievfiv{f{eev{{vjgi{mylvjx{z{zlxl{kixiievmymhjihkmlw{{gwwnnvfgmxlxyjzekjijzggzfgzfijmjgeijkzxnw{h{xii{xynvynn{fizhghxwjwhkey{ieimjg{xjvfexfvwzjjkikvligkihe{hgvjxvjzxhg{gxlyfjmnnzyjivwvwnjfm{hjiynmfzn{mhe{k{xzxmwhmhexf{yn{exzfm{gzhmvwvnfxy{fkxhny{hyhw{vjvlikzzfknyvjfgyh{evynwwfigji{{{jhxyynfyjzw{ifi{jezgx{hjxvl{{gkgkwnnhgmwhmw{mn{wly{{lgzv{mlvfkmvnkev{fzxfzfhxjm{wwhwwexivizkeiv{zzh{{{y{ykgnwwjzngekmkiem{wfkvnjziveziiizvlhzvwzhjg{xjzekjmx{exjehxgmikvlxhegzjznnlgmhg{wjxkegkvyimjzy{zffivfwyhevjgvmj{lznfgmh{jeihzvl{ixnexzj{wnyxyzwxfyfjigmkejggghvn{{jheixzfjgexkevwzvzhxjyygzjeee{hxhjkhi{fixkmyfwj{wylhkwwhxeemfkejk{yzyxjimz{wjzzkkwj{vyyjxhiiekgvynhvh{zjzxjfvylji{lxnv{nhxnzxegfziimhiiem{vyhfx{{hv{fizy{fkiknngxznjzigxwnnnnjzz{zhywgkvhjzivkk{wfvjzvnkgjmyhwn{iginjhmjgvfeiwfjezwmwiziikmylnfmfz{m{vfeimlzhmhnhjmjmmjzwiehxmlwnezy{ekeijm{wgiigekfgynjvzlzximivvnn{y{ggnf{k{xfmggx{{nyfgz{fwh{hwnhmwn{ifevhizgivlzjvyhifem{jinwnjwfeenfwhxwzfm{zfyjmjivwlvnmfegzwhmkim{kgvygggkhv{mzhigjefkhxnjywjggmvyzxxh{hvniivh{ehmznfgggkggkexmn{fkkhxkkxwxygxekfiwlxjn{{kyh{m{jkg{jy{kmzjmfmnjxxjxwkeyfgknnzjeegvjzzl{lekvnjx{vegeiyfnwmlyykkvhmwz{izzzzwv{mlyfmnwwiimwjzikein{vlwjfgmwvhw{wjzxxlvhexkmfev{{kjz{x{kywnhxfkex{ivylmnjeheekwjylvjmyig{emw{y{jfv{lhezx{vzhzhjmz{giynxj{nfezyzfmynyfxwwfgevzlvjiejgfenhyw{yheyhfgnyfzei{jmlnlfxyfx{kemhzykiylxjkgwj{{z{eghmmfkm{vzxzwvwvjjijzxhmlwlhk{l{zhkmhnjgeizixzyzljeggzhgxz{wj{yzwmnnjwnyhfzgknlhgn{zviey{nyhm{vkmyyyfnyn{v{kkfmkmv{kggzxjjzjikknnnl{mhzfizjheznhv{wzhjznheeyfmnzj{jvyhkemzhmfheyh{znhn{hiylxjgevfjxjzjekihejxvhezyfeknyn{jzznhm{e{jhkyfhgke{fzyx{hiyynn{xixzw{lkkexhk{mwfv{hm{ewfv{ezvjxn{ihkmlgzjigzevnfez{njgemjikmy{ylimmy{emwjmvwvhzf{{ezjxjkz{hkvhvlznjgzjjkwykmv{zzjv{e{eivgvvwkiwyynvlwhhxx{znekwfwwkkvwnwkemwkg{xmjkkvwm{jzzvkimngg{{hkgvfgxywyjgkgjiyjggkex{fmwnz{{ifx{vm{kigkzwkeyfgmfmegzxggemixxnmljgexzfnlwwnwivjggvezvh{{xhznzjhz{emfiiizezfkxjfijk{jnyzyv{{jnwnh{w{i{jzwkgixxjwjzxeekgnwyhn{{h{zvyzjmyhifmnjfvmlnjxfjgwjimizevge{kje{mhezjnjv{eekghmzlwfw{x{vnfzxlkiyh{lexwljgexy{hxfvmnzyzjkgxhhkwjfxvj{ymyhemjizvnz{wnzlkin{hm{lvwig{{mywlvfv{vnivkg{wxljmexegfvvwzfnjny{fig{k{{yyw{ywkghe{{n{{yeiemjv{vvfhx{{fg{wevyhyfizixhezfxj{efkgkkihmvwji{nhznnkgkkzwzyy{kkfvezfggxgxnjjz{nm{{emfkmzl{mwn{z{wzf{lywgmxwexn{xnvyjm{fezzzjiigfknyhvegjxxjhm{igxev{jimhvimzfegnyny{yz{fizxmfzljmvjeifkgk{lzvvjznzz{wfexljzkew{gxwf{zv{xlnfz{ee{zv{zxy{mnyjyfzzmfeefizvnnxfhgz{ikggwfhez{egkmhzfmxjfemnvfnjegynwwhzggwlwwjeigkkw{jxwlylegmnfmmhfiwwxfwlhzvfggnjgkivx{zyizhe{gmlei{jxhfzgzjvxhkezxwjn{iizlwlhzivnfgimfvfznzfnl{{jx{ny{fkzxwnhxiiz{ylkg{{{z{fixfiml{{vjimhz{mnhgzzyiimnnyw{xlnjfkw{fznfvynhfm{gjvizwwnlvygv{em{fzfkiizwfieevyizv{ggznfznfnlmygkwwekvjek{gvjgmkmzljgjmvl{lx{vfemv{hggzn{wnvn{yhxyjmyeihiw{exekm{kkfk{xny{yxhfegiwjhiyhvwjznhzwjk{gnnie{mzw{jw{jvv{m{{hgx{vvy{weeek{mikfm{vjxzxeikk{wzlfzjzvnwjkgfix{vy{fegzxyfx{ylv{hvzvmhxhixjinyekhzvfz{nlvyivmjwj{vnjigjgzhiijzfgw{jkwygijzz{jzjgzzmfez{v{wzlzzmwfenlhg{efz{vzywfvnjew{ywmlzxnhjkzwfzwnzngxnljijziz{yevkmnyhzxyy{izegmjv{{whzkghvizfijewy{xzwwf{yy{vfmfjixhiefzxhm{nljxhvv{fghi{{{wmfn{zfevfeikxhfgxwmfeiegzhzjylm{gxjvxyvnmyjevjmwfzggeziveezngvikjizlhk{yjvigmlexxwge{{feynhmmhhgge{egxemvhnlzvzjynfkwngeeiizmj{jzzjzhx{fnjgizx{v{hfi{wfehxxlmfyygmzyizfzgxhxnfiixlixzyhiivzwjxgzxhvlwfw{vfzwgxy{xfxnzfzxez{lmj{kigyfjixh{vhgnyvygxkkywjmfmvyxwgxzwwwfijxjegehz{njk{{kmvlfg{xfzwjyhzn{jz{{zvhgvfgmhnyxwjzvjiifekgnn{w{kwfjmfewjevimiveeei{v{m{gvwy{ynwnyhhzevnnnweg{hmnixhvgvkejmgkgxexzw{ixfxhiewy{vvjjigxexmlywnjjvzy{ljvjxnnzvgezxfeexzjke{fmhjevygkznjkiezzw{jvfz{mgzxjiixhkiv{nwx{kgynkkgvvlxfnnik{zyngvzfvj{hfgz{yn{{igezgkjefmimm{hi{n{vivxhhk{kfegihmjgznw{{{myw{hkkefvgghggm{kez{lx{jehmmfekegjznfjgemnjzvnfyn{eeizz{yjiixzfighm{fiizv{zyfexx{{knwmhiejzjgwnmhgmvfz{igvwizvwgknlnwy{wljkgvzzvlvwxnvljgjkgevl{nwfmyhe{gzwmnnhzjkezvyhhx{hzlie{xznwlwlxlemegfxnjnwzlexxhhejxzyzhmnmyhefgeevnfgkgmjjz{xkmkgmfkifikmjkfvxwy{vy{nzlfkfghxmyzzivwlvl{nznv{nfwyzwgzjigvmhmlgk{lvwemhxwligmj{m{evlnhyfnwhkke{wmwei{jighvimzwhzzfizzzxygznf{{fi{l{lhzemizyhfzkexhjkzfx{vjgejkemexgzxnmfjihxfiiefehiizvy{nnlzhvyxfeifmhemh{wwynnfi{x{ykkyjjmnhigjgxhikkmn{{izz{wnyyymnjin{yfwyiievfigkgzmfimnwwynjnjyywwvhgzzhimynjxixevkmnfjmfmzzkkyfzzywzl{yywwy{{jmxyixkkfkxykk{l{ljkkezwwhgvkgzfzwxfjgyhvjxy{wgkixfewyzlz{y{mwzhzwvf{{kkzxjxzlegwjyfvj{wieznx{fmjvkmzlzyjvvjw{wjwhwhnfxfimfehx{gmhixhmwfmfvjjiez{zmhvynwwnw{jknhwfnnwykk{{w{y{kijv{mwhwf{{wynywlhmxyzxhmzxnlkmvl{zz{kezl{kjmfinnyn{ewynhzfyhzjx{xjjevwfv{zhiyf{j{zxniv{zvwwfnfnynyhxhg{nvjzlw{nnnyxjfkz{jk{myhnlmffijixwjg{{kg{nynzzjzznzwkghvwnizie{w{{ekvhnnzhhkvfvlz{{ngxwjnjkmmfzwkezxhzn{feyhjiz{{nigzfjgmyhin{jmy{{khknlzznnivw{vfei{hevvwmhvyjz{nmf{fwjezfkyhwnxwjeemex{hkmynznjxy{kmjiy{kgkgekkifzgmevkgwj{vmy{fwfm{izxwywv{ikggggezfegxjxv{hexjvy{ljejeez{x{mzjv{xfnhv{{fizyyiiexwwjgmhwynljv{fwh{gfvhefekkjiginfjgixhx{lke{hzfnn{leegx{khgfvhkwfgmjxgxvfizw{nnzl{z{wxnfihvfzkmmjy{kkwj{hwfyhzn{kkexwxyixiv{ngkegy{kexjfivfjihvwjvnzx{zzjfmiexymymjny{yjkmn{yhzxlmnhi{{{enljimj{xwlikjxmwevhgy{jgixxlw{fijkizn{kmkekgzhx{jezv{vhgv{exegznznmfzwikgijz{mnjhevyhxm{njhxmyfmwlgeezxlexnyvyix{{w{wlkgzyfe{e{jigznywvhjvjin{eem{xhv{z{wyy{izigyfgekmgeizzz{ihmnjgg{xizmhjkwfhxfvv{vnwhx{gg{wwjmhixxyz{wlev{vgxfvjkieynwnhvvnyhy{whvjwwmwfkjkjz{zfgnyvhn{zjvhnl{jnfny{zeezxfvn{kexjwh{gny{iwjkenyjzzvhmjmemjzjkzjvwywyn{vfe{m{yfk{i{mzlexem{{gix{zw{lyngmvw{vizhvzwywjgyffkzjfmgxvy{ynnhgw{jknfjzxlhezvjvkkhiivhkgmhkxwzjhgekzfeg{xfvxnkkxj{jmnjmml{l{{figxy{kefgkgmjzzhkjxylvly{mynfnhhvjxwfwnnw{l{exyy{je{lizvyimxhgv{zwlgkkmy{gxxwjzvyjmgejzvjfvizezkewfim{hnlvl{{jkxh{{{fhekmivwyvhnfigxfjv{fvyzwezxfhmzn{mmwzw{fvfvlnnkkxwez{nyln{fmhgxwzlylywhgkehvyhzyz{eixfv{emwwheezjevjkkgxjzmljejvjinfgz{vggzfez{n{e{izfxnexfvvhkijgixjzikmwwfzhjxzhmhhmfejeexgehxmyhvnl{lwjfiwwy{eemwgzyjvhkky{jiimzzikkevh{v{ywhjiynfxhm{fywv{kmfmvjeejkkk{{hmjzvhyh{xwf{yznwfmj{y{gikkmgzhxwfkknnznn{ekhigghgkin{z{xlgmigjimjyyke{hzh{hhzivvjy{yfwwexnljvyyevjefmzvv{exwjxhwhx{hghxnlnjfgy{{wywfmv{mfxlvf{n{e{nfimyznhxwyekkgzjiezxxn{efk{xxh{zzwjmyjywje{wjgmwjikgww{yxnwlvnekfiiegmvy{vwfezw{wwnjivivhmevzlhxvnivfmwyikfm{ygv{zwymh{yvhiigizzm{emjvznmljegzxyggzvfvnjw{{zvyeewn{gwyvhw{kemjyhmyhvixxwjgmnjzylemigixfzfvnjjgfemfzvkmnfnl{fznn{yhiezwhgmf{vixkeyy{leihvnwfv{zemwfv{hxfe{jhiexzhmj{lvhhxhxyfekhzhxjvjijxzwyjvj{zzwkmgxjeez{hjiwfxngzmw{z{my{ivnnhzkiylkgmf{ix{xjnwmfnjhzy{vh{lgggvhzezjkywjijgikgggxje{{{ffvnyeigz{xjx{njzfx{nggez{nkejz{hvjmnzlvlgxjmnnge{evlzxyfmlvwyyjkfzvwzhvwkgzyemee{knnmywfmlzveefen{{j{yzlfkhvhgw{fevwylw{eiyfexjizwvnfknhy{{vz{yyimex{wgxjzvyfimlnfwfyfzjhxzxgkfgzviv{k{i{ifgn{evnhjgmy{ejmnywyzjgennfmwjjvjinykefghzgmwwvfjmzyeeyyikyfezmynwwjhvmw{wwn{izy{xix{mgx{v{{z{ivfm{nhmvhkmhzxywyw{y{ixjv{jhew{kixhx{hvmfzx{wkixfwhyhwnynikm{ien{mnhmnjnjgzmjhifiekkmkmjgjzgvjmfeexmwjim{yfjxx{vwxfy{mn{wxhievwjghmn{xngigieewngejexwfkml{xfxjgwl{iggzwjijmzjw{iv{nkg{gfz{w{ljxxjjihvhvm{vyywfizzwjzhwygekezfzvzhfmmnvyizmhzwzzwjizx{wfgvivgkjiv{wlvjjxnl{h{vgenfnnwjeziinnemyyvnwfnyv{ylmhwwx{{ywnhvfkyfhkxyegnfznemwlzlemggfmfkekzwzxnhkivwjvnjhvkekigg{jfgjimyixignhjemhhxki{zzwiiegzwievhmhjieixyzfv{vlkgeizfzfxwhzjejezynnjejkzxvfeiyh{{hxzlkekmkgzn{gkiie{zexnl{yfgmjxjekmyv{nlxnw{{vzwwlgv{jjmjmxjkgn{km{nyjwfxlggvhznkimyvykix{ynjzjgxwwnyf{vvwxfvwiggx{{yhnhyfx{nlvhgkgvmwigfevjfxylmnvnkk{{nnhefxwhvlhe{fnngkhvfvimkemwylhxiew{nyzvjkfmjziiywzxmjimgijgizv{{nzzxyivzh{jgkmfggfxixznjzimmfkmjxvffkyj{jezxjjxfmywizfmimivhk{ymh{v{kylivnwwwnwjkzy{m{g{{zxwhigvjzffzn{nfigwh{vm{zjeg{wjgwfxfgzjvfxkkiexfvhyyfmmwwfizmw{xhxxyyyfe{ieivfyjnl{whvv{ievnzymneefehgvynf{h{wz{ynkmywezfefmkgkkzjgxm{mnhejvz{hxmfz{ivz{{wzhhmhmeieegim{mnvwxwxnzh{xylml{jhizyzjwfzzfzyjfejiwjgz{j{nik{ewlyynfnjegvhmwiifvvlnhjkynezhzekevgigxfiiixlvjnhxfn{{nimkg{n{nvfwlz{ezzj{jfvyf{fmhvwhehmnjylylzfzlxhfvezzfigyjnh{kz{kgz{kiw{yjmnekzj{g{wmljiwynjzyvnzljvmnzleg{wmhzf{hzwhknjvnnhwhwhjieg{{hvfxhxiewlnf{y{{xfywegkejvxh{fmhmw{gjmixnfnjfzzyzhfkexwnznzw{emlw{wnzvyjhmmh{v{yjghkmyjxzlnngxhevnegfey{hm{kfkggfxx{mjxwyn{gnnyjvnjkmjvyzznlkkggywiikkxfhxzzzhhijvhejg{geznyzv{wmwmfwj{x{yemynkijzmn{fjxhmgg{imwiizh{ifkixvymhznhz{{zvfzjekiikmyeg{jvfywny{{x{znywgzgg{ygmhxfkiezjfmnfexev{zxwkifiivjifxwngmzywhvfhgmjwywjvl{{{izjn{fkmlv{{xxnnfnhzxgekexh{{kmhxemhxki{ijzzfeknjhen{jinhkejvz{izzf{lz{ivzymjn{{wxlmnvyznimhvnnmhmyfzigzvxyvw{m{l{xkkggfez{ywgijk{nfmvl{giz{kwwnjzhmlnngzzvjzzvegwwnw{wvfhenl{kkmgihzwngznwigevvjvh{xnhgzhgzvexylekfm{zeeimfzzlgiywhxkeznez{hw{mjw{fmznfimf{x{fylwhheivnf{ymwjgexhigzwwnnnym{nfnwvhekezhejkwfmfkkvjnfekjihgemgz{jhxv{{{kgxwvfjexjmfx{hmgv{fkgz{vlvwzxmy{fmynlvfighmnhjeeeyf{izjjvwyhgikn{exznjmvlwyznigzwkixlmnke{{fmkewwjezxmj{i{wzlzjzxfgyyjgzvzn{igxzfkgm{yfz{nhfgzjexfxgvynjxm{xwfvyy{wy{ekwj{{jkvfemzjzyvyvnggjkwhvnjgimmlx{gz{ygmzlekvnii{jvjyyjky{gvylzj{fkizvzynyzv{keekiik{xwl{iwlnf{f{yieyhjzynvn{{zyjmxfw{{hixkefvei{hzzvhxweeii{xizzhhmeggkhx{lylvl{mx{kmimfxjmmlv{fxynnf{ixfkiwnvlkmzhvhegyhfvwwgvzxemxfz{{www{niznhggxyxww{nwmjivzjiikeeeznxyjgyj{nyyev{jv{ezxfzfx{vl{nmf{y{ngmnnhmnj{nhgxhzfixzzkifgzzfgeg{zgzgewlfknyywjmmnvfmf{njgkg{mgmvlylmhfi{fkgzn{n{ngvfiznjx{kxngmw{xjhe{lgivwvwmhnnmfmwjkzjzfgmiexn{gixhivwheyjhvhekgx{kgmjnnvwjgxj{v{njggvhxvfhvzlfzixhehkiiiev{vjywekyhgimh{hyjmfkghe{giigv{j{zmhzxnfzwgeyl{hzl{fw{igjizxmhjmeznlix{{vnhvfimffv{yhxnhhzkmmyggxhfeyjm{{gz{ii{{zniknljxxhnyznjxjmzjz{zjnlvfvhfeimfk{mjxwhixzxfzjvmhjm{znheekivw{i{lxl{wmnxhwjyjiivlgxmnzhmjhm{{zjhmvlgxje{yhivhgzexnfxljv{h{hxjkenjikmffkimzxwlimekgkikywzyvhznjezjkey{{efgzwjzexgmynyyhvkgfx{gjkmyxy{fwywwxljzikgenjfmhezhynevxnyjjkzjwjy{m{mjhe{w{kvnvlezemnnvwvnzfvn{egxixmnfm{nggzjhmggvljgfizfjzezhvfxvnhxzlvhgximv{znvnievhevvygmjijkkg{ffmfi{jjejv{h{gvlzjnlji{fy{vjnjmhw{y{xy{wiiivvj{kmhvhgm{eheznzhvhjkwnzzmhemwyhkggivzzxjwhjkeegexnji{xnhnjhxfiylfgexizhzexezvfhekmmf{fv{jz{mvfgkjk{ggvzygvjzzjnw{kxnvnxnhmjm{wnj{v{vyh{nz{{v{wgmhvjgyyzhemw{fiexwnylvjnwml{xmyzhvjekiinhmyeeizjiynwwhkvlxwikznkmzzz{xfmlhgwl{jvyex{hzlkijzvwnfhxfxznwfvhz{jvgiixgixwyl{gzhyyjmjxjeez{{few{ikhkyw{ifivh{l{wznxlmynwmnmjhezwkgmwznfmz{vfignhnn{nnyegvfwnfivlfgnyzlvyzleggezvggimwlfvnf{givkmnwwygghmnhggxyn{gmw{vfzvzhmfiivljxkiznxjvw{znw{ywl{h{zkkmf{kgezx{j{fm{{j{z{jmyfzhzwnwfmyiikgvynygmvhylgvhi{ezn{eeizhjm{gy{zz{eywjifx{ehxjv{gjgfmiigxkeii{wmwwwggyw{gxjjimjhxjvx{{yivnnixfk{gjvmfw{yhwhhxfgmww{hzz{mwvnkiegikxymlizvhhmxnggfiizzyvywnzlhgvyhzimmhzhmlzwieimwwwj{mfz{nzjexwhzhw{zw{njmwlmjzlhkmjmyhgiznyfihmhgfen{zxikfmjzylkkzfmjyygiwnz{nwkijizvekjxjmwlyhvh{{xlixvjeziv{kfm{hwweewnzhw{jzfxxjgxgevy{ix{igm{{iywynwyfe{jxjv{kgm{{nezx{hm{v{lgmgk{jy{izfvx{m{izw{{ly{whhinfggjkfvkeiifieeievlevzfmwzwmf{{{iixekmhxnynyl{{ivn{ji{xiejg{zgmjkzwhxjefxjxfgfxgzwlgehmeky{nykekknj{wnj{nml{e{ezygmzvzfmf{wxy{jfxhzhx{{xfmf{lhz{kgvnl{xfkienjjz{higynvf{m{lz{xwx{yjgkywimig{wie{zvjiixyz{fzynxjvw{jzj{yfvikimgvjejmhzge{wexwffvivvhgimykkgkmfgzjmvw{gfkig{hjxfzmnjvixgxevwn{nwjmfxligv{jkvlvjzv{y{gevnhnnz{xywyfggxv{xygx{veejgggkm{xfzfmizhzvhnjyhywggkknfhehkjkvj{nzzikjkmnjemjjev{x{hixhjeznzv{jvnnjyjzvynzv{zizzzmlienwy{w{hkjzjgwwzvxnevfvkejmywzjhvmh{lgvfzvljkhkzjyfvlek{wnnhmjkgxvhgmfkm{whvnxwvhfvmjfgzw{nixex{vhe{yw{imkmxwxfzvee{xgmmlvfjz{fimmymykezzeznfiiznimm{mjzvylzjhvjegvxhjmkiznhvjxhk{fzhxjvwevzzxwggylikgeywv{ekivvlvyvyfgfxnfki{my{exvnwlyyvfvhywgvgizjwhvnevxwm{{n{{{zwnxhzyimwwzvyheknyxhwn{vvw{w{wiiiexjkev{nhwwevyfeknjkgjvm{gxylvfgxvfhkvlnf{iwwzjvjw{njfvw{{f{jvl{xhm{{njx{finfzlwwvhvjez{hn{xfzzwnkiwwxnfmiizzgknwvfyhjgzyzvzyjz{efgyhkihevj{ijxmyy{vhvjimxhvhxnvj{vw{emkez{ggikizhxzymlvnwlzweviehviey{evxngizjkikmjk{ewhzxyj{ykg{vgefk{ihkmyfvmfgzy{iixw{jwyxlekx{xngxjznhzykkmnm{emmwmn{jhifemhwh{zfgeixhwjkizxhmfehv{vxf{kyfgvxfyynwieizvwfm{v{wvfhvhzhzjmvhwwwffgex{zezm{yw{ywnizjkgmiknhvwmy{yvnfvkehiwfn{vwzffmmnwhyjfi{eynemggyjexzj{wyfzzmhke{lexzf{{{vfvjvnlgzikwfeg{nhxvlfe{wvyezkkvwvlwliievfxhixyv{{whzimjm{ijznn{ngeynixznjzjkivizgizww{x{fenfzxezyh{{gghizxwf{hgizhvl{hnyixjiwnznx{hexyexjg{j{mz{wngxiieeii{ijijvx{zjjkv{fgvyw{xw{xnyy{yhzxhe{h{wnjegzwemjvwl{hmyfgwn{wmnn{v{zxxjnjiinlzwfvzynfhkwnheig{innzl{vgvik{ghmmn{lkgiew{gvfzkkvfvwz{{wgvhvxhnyxlhv{jyyxjhmwnhzikvnizigkijznnfkhzfgvlgihxynxneevwjkimwfkgevwnm{xlnjwhix{nz{izjiyfwwkgv{yyii{gim{e{jn{yyfkjgywjmgx{kekww{fnwnnmjnnmjjvm{{jgknhvl{ny{wyvjxhfimyjvnnvlmfggfegvvfegxwnwvyji{gynjemyfgnnezvwmhmwmnzh{x{fnfjgxngmhvizfkvnzlnwikwfek{y{xfkevekzlhvnlggyfkkmyjkyh{iv{fggmgg{zgkem{mkkiiekmh{lnh{xynjxfxfxw{jz{ljgeejxml{kvfgmylfimlgvhkfe{yyyzlwnzxekmnyf{{xwnneihgee{vhi{g{xvwhmzn{hyjhxjzekjmiviinjhijgzwheyjjemhhzxh{{fzfzyfhxkm{xiefiexx{yfv{wj{xzjevzvfgexn{{hyhezvyv{gvm{mngznlkkz{emkgfigxfehe{gjgjx{{m{zxwn{ggg{lfznwjmxlkmxwnl{hwnixzjexgkx{zfyyfifxje{znnznyl{ffxikwfn{vfzhmfexjvvjvwzjvlmj{wvwnyjxwnhvzw{zizwnxjkkwwki{yfiwwizwyx{{zywzl{ewlgmvwjiwwx{ggzfexw{mfgvnjmfm{{jvyivn{zl{e{em{yfeenhkexjnn{{gmvj{wnjmniiik{{y{exvyimyfhijxyfwfhgzxnh{lxlxfwhzjegevynhvywixegxyfzjinyexvygzzx{v{yyhegnnmfxh{ifmhgkkgvxjeinfgmee{zzwxlzfnfemhx{yez{lvhkmm{kg{nyn{{mhvfjghi{mxhjmvlei{v{legy{ylylign{zffxighvei{{ywnfiefgexeggefi{{wyexiekgmhjkmniezvjkfgjmyfjm{xix{mimfihzikzvfz{hzfjmkmezzhnfhvnygkixjmmn{iznivvy{ljznljzvhixxhfmgeizz{ivzzivfegzvjjxigxyggmhzhynwn{nekvnyhjzn{fmmhwwexxjgijkgegezwylx{zlem{zvyzfzzn{zhn{jeixnweejgev{nexzhyfeexwzjy{jxkkjxik{keewnwnix{eienfzlhxnf{eyhvnnl{{vwzwkemfzxvyvhkgivw{{ewyfeezjzvjvnzlxwzzhgjz{fzynjiemly{{mgk{zyjnl{ijgxwhxjz{nivvh{gnfgeyjnhzznljivfhzvlzvexylyhfinhke{geghk{kx{gg{eivkgfziifiw{gzeiexx{{jwjnljvjijkyjxjgmvjwjvjn{yyywxnvlznwlwwwfkikijvhv{nkexwwfeiywimfkyyw{nnw{zhxhfiizzyxhegwjmwnjz{ww{ykenffvm{{k{hxhxj{yjmxnxhzznnmj{wwwvlggjmikfzjezxhvx{gzjgxfixzyv{ynxlnnezz{mlywzynnmjfzx{xhigwlfvn{w{fmylfgnjwhkez{gg{{jvieekkmxwgin{{nmjjkywzlzhmyjinhyjyy{iynv{{nevhk{zywx{whjg{eii{kzngmikzjnyz{jmm{yywynffizlvjynexzhhzznvhkmgxjvx{ivnlzx{v{kznylxjkgxwvwxfiiv{xnynjxhigxxfmfikgmeeeg{jvhkivhvln{whgz{hekjmwhynfezfek{izvjvjifkvwv{iefvyfizgzjmylyyn{vl{fjzxfizgzikxnfziz{jvhwfz{fm{jhzgzkmzhmjzjzhmjhvzvivzv{y{jfzzwjmzyxfy{fgfgwfegggeg{{vyfihmkix{ezzyivfmwnieeinjzlfifgevfkvfezkikexwzygghxznzzexyjginyw{{gyywnkmzlhe{ejzhzxnywmjznmnzw{jnjkikkhkvlkgz{evzlfzmywnz{yf{gjihmw{m{wlgekevl{hjmiim{zwiefkv{zjeihkvlvnvyjinlywxyxh{efmjegvzzznjemjzvexezimhxhmylmfnw{fjvgxjkyhekkmji{f{enwkm{lvlnjzvzjkizngezzhggmiiim{ljexlhegxexmlvhhejeekiefe{jmlnfxfx{hzmfikfgyyy{yjgkyw{efxgix{vnwnfvzyvhnymfgmz{kkwn{hxjhzhkfzvfvnznkiwlvyvlfixffgxnfieifmyhhzxlwh{ygxwl{nfzevmjy{jm{m{zvj{jjzyfeezyeenh{kkmkmznyjfmzyzwizzxkmizjgnfeiixywvl{mwyivjxwhyyv{y{xwfknyjgwynn{izwywhzivmlggzwfxxfizjifkzlyn{{wlhkn{jgvfzzhzwhjix{wykgjgznvleghzjgwlvfizhgkiwnix{fhzigwnzyhvxnwfjg{{fzw{hi{znhmhxnzxhxfgii{gnnezzxvjkizjemfgmj{nyjzngkmyjzxly{ekjm{mx{nlzxyhixz{zy{gyyny{nylfgiizv{zexjzyhkmgey{gmfiivevwjvw{jjxigzwzlvj{eem{xig{{iikg{x{fzfmlfgyjnwjvmjhggxhzfgivwjzjemfvw{hmgmyfmnjk{e{lnhizkinw{g{l{hyfgehgfgvlw{mfyy{mvfjewlzxyhkifkz{geki{yhxekmnnnzhnlmwfi{w{z{wxwgxjg{lw{giyfxhivzfznivnl{eigwnje{ggigxm{wynygkgggiwlyhfknn{fm{z{jmjv{knwixfivwzvgx{hhxgkezfmzyjeyf{eggnjxlgmikfveiywkgmf{fzfemzjnhmlmwikhvjijgz{nfivyh{zie{xnlzyxwvljkzjkgmfy{yyfgjvekzjwnfeyy{fnhn{nhexyyzvzz{vml{gjkiz{fivzxylnjxwjzeeeev{imznkgz{jgjejk{jgiznjk{ijgjiimnyxn{wmy{x{h{ezwn{imyfzjhvekvj{wyfvhivgi{h{xzfw{fifkeenywwizfvjkexvnjifmzyzwzfz{vfjzm{zljmmwv{jzgi{y{hjxwhmffvzzjg{xieizzjyhkmiv{jgmmyvhfzyy{lzhjey{zw{liivheixhyhylv{{ykmmjggvhmhznwfvjnwvwyhfzig{geky{ek{lhewlfezz{hnnxjzyjk{efgeezfxwexwfivjgxhzwzfigzfvjekzhn{fvnnikgehvnlyfxyvwywezezezjv{xwnmh{{x{ixvnivizyfnjvnyjwyhkfixnjkx{fizjkk{zwhzl{vylzf{vv{vhgzgzfegg{w{xevfehzgz{xhe{iwnfghvvjxhfxkez{fgie{ijmnfjzznynkkxfvyhxgieevwiikifmevwhvfwl{jemzhzwvwnfnjgvmjvyyh{jimvykkjiikv{m{n{w{njkmynnhmfvwgmxfgewhwlfzvhxlfvhiivyjzzw{{hhxwlzxzl{ehxxjfkimjv{nhznfznkgxfhezfzf{k{jkgexkkixnwv{vjjz{xhvjezyixjiheizgizjnhem{hmhz{iezwjz{ieigvznfkmneevhhejmzxjk{wylexzjzl{lkmmnjzxnzhjvevkmgk{j{eemvyhxwl{fwngmkmgi{eemixwfgmieevnnzjggfxhvmhmw{khvjzyfxfee{zixyyjgywyfgeexhgikmyyjhxgmvhgv{v{{izylwhynhvvnwhmyjxnhmlmn{v{{mf{fexheyhfk{j{lz{yfwhnwzx{{hihvfznfhgwyigmy{nfimwzniznwyyznjmzywhhvjzjvzlzleifeexxjynjmxnnj{jzwvjww{jxlzwy{{jvhmlkkmwigzz{v{igvzfyhy{gkmfezjixhmffefmixvj{m{my{z{zzvn{xz{nhvyy{kivf{{{likgzmlnh{i{zjefxjiml{wnyexnjzzxjyygzkkhv{{exzzimzzjevn{vfz{jyhezeevjz{ezkkzfn{ikhk{fynhz{evfzvxf{hnw{fjzxjgxxjzv{nginjzjhv{eixixzyjmegfegxjegvhv{zjiwnxw{fmhmn{y{w{lfz{gnhnhmhkekmemgmgkzznwxjwwnykk{vm{gvyjiiyynyhevngmz{mh{nemiehz{{zlxwnygxm{{xxlyjmyvyhvgzwygk{k{gkmhixwhkfx{jemzw{vmfwwhxim{wei{jwf{xjmm{vyhzwhkknlzw{igv{hnnhizvhkjknfmniijvwwexmhylemfifzivy{{w{wfknlyljg{y{{kgvjvfgejkwfzyfmwn{f{xjxhenjwlmh{jzziehvfmeg{gzlkijmkmvfikjkzjnnzlzfnwwf{nzzeegeeeyfw{zwgxyygzvn{w{ngi{zivjgxyegzjwhgzfmjkfgzyzjkgievfimhvkigiwwnngi{hmlv{egnnjgznxhhm{kjenfzxfgevee{kz{zvm{{vemhz{h{whknf{jmfik{jnfemien{yfmlnl{fvynjnhfzxfzf{hyfnjzl{f{i{fmj{kimjgw{hggmegzzgzhkfevhnwzngmylimjkn{{m{vkkfx{l{eyh{x{eeew{he{vn{jv{izywyzyjgnyiin{{ijeie{wnykkzyhv{jxnfi{{zhmlwjgejzgxn{eiwygkxyixizemnwggwwezwyzwyhhghmgmivvwwlfifevhjgkikm{gz{jgxh{kjkznvwnnyf{xm{hinljenjfknnjmhm{h{vemm{ikfzkivnigyfyfegvw{kjmfgvhznivizegimfimhexxjikzyhxxhzziizfw{zyvlizigjgiivfgkkihmkiivwwxhjgjzhvjmwffmixkmywjkixjvyfzwzjiikiw{emvhgi{{njxyw{m{{egmemgg{xx{fiyfee{lizfgjxxhn{fzwleefxfe{zjigvwj{wiv{hjxjgjv{ijzimyy{ljgw{{f{x{nzz{wxnyymfezxyxhhxzljz{vzhzn{gkk{zhvn{ylmwnlnfjkjvmnhxzhhm{nyf{gfkjv{j{z{hhvhemfzwheylfknljgiigznyfzjmjzjejejmvfvlgxhxzyimnyywyhikjvimnfjgekfe{{izevmnyyhzfejzvfvfjeyyxyevexnhylwhgzmjzfhgnhgkxj{k{zhxmyfgmheeemynfe{nevjmmyiemf{jgg{keg{eegkieejzmwwjemgiwfheyjkgvl{xnynfjxkimljehximhkjmmf{wwlimjgmlzjhz{ynnfe{eyhfikmxf{gjkzlfi{x{jjemfzhmhzxnhmjmh{i{efkggzlyyggxfxhzhzygg{mxlyyiggigiixgemnwyyyikyliiyf{wfvmlmjynfvem{hxl{jzy{ixnvhny{vnygmm{mfgghkvjfgfkjev{wwjzgxwfjkzvxlw{zjnyzxfm{vgmnffe{zhm{{nfim{gn{nhz{{i{lxfjgjxvj{gjmjzevynwnmlmhfzyj{fxygzwligikkenfv{eiyhyhzx{{wyx{he{g{jxygivyhxhewwjzv{fg{ezwzjhvjzy{myw{ivvy{xwyhexjfi{ifgzhjekeie{znykiimjxwlgeyym{xhigfikkjevwmwmwgxzfeeixjixhjiixnl{hhekgki{gnhfm{{xlfihx{nvj{ximm{vjzlmjx{ge{lnf{zkg{ievmfnyjzkigikghgnfexynvjjznjv{vlmjfxzxmyezvyzwn{xyyhfekefzkkiijxxl{egemnikwjxnwjwnixzwfg{zznevjijxizyfkkfxezekjg{kvhiv{vhxwygkn{{zwnvlhkhzkknwz{{ynlekn{ww{g{n{vmfgzkm{nmnnhmfxwmjnl{myjmnnyizmnzfeehxjzfixjwwzlnjhexwyyjmmlnfyfnl{xnh{jzyikfmyyvnmyynylvnyhz{hv{vvyeveew{kijvfmighzwlmfjifxyhvwfzwfgknlfx{evlwjivvjnnvyzxvwzlyfiehvigvhiikiixiiimwyxjgzxjwyjvmy{kgm{i{lvhgeylw{{igiz{zlevxlfzvfnnjvjvgehe{zz{wffmnfhvjez{kknjexge{ifx{kexmhxynjizfkyhm{gi{w{hggmhgiwwvykgikyf{hmyjm{negvwzzjmgvxhgivnnhhmixylzwggmfylgejieehkxnnlignf{zixyyikv{hv{ffmez{xzfxhxfwf{hmymfgkzlmlexikywgxv{nwjxzykinhv{kmhx{levikjveeje{kemxh{yzz{kwwhgixiv{ez{{lhm{vnljzkk{wyhkghkwlvjxjivnfjgml{{mh{evyimxyeegghkzjfezyfmvyzjyhjvmnzwhmmwfxfiexez{jixwjjegmz{wnwhvjee{{mhwjfijvhg{ijzgvjxixigjkiexjfenfhzevjmwy{nmf{x{{mn{mnwwl{imj{zkmjkxy{w{jyyvfixwjxnvwwymnnynfjghggizwkgyhfimhzzhxhxylnjix{yjegvhzgeiimhnhgenjjkizkimy{h{xwj{zvykifenhfknymh{mjxfexjkigxvlvyfxgmzhhknjxwfiemzfkgnh{mik{jjvyjhk{lgkjgjmwy{hevfvimxnmy{y{evfemnnzlfxzjhgmjyyiefefgigikv{zhhvjzgmznmygvnf{kvngm{nvhhzzy{njmizxlgxwfkkeggkee{xkemf{xjizl{mzxvfzyvj{evwxwmwnfy{zzwhwyxfgvvhnnxlxnw{nlz{kevyxwgx{zfkjiznegiiikmynlxfjehvywvy{nyfgejxizkgjeixfeyl{knwfiiezlgx{fhxzh{xwlfikkhzyw{mzfnwzyjknhjkiz{yzf{g{lnfmwnliefgheixfewwjgnnzjgkhvxlwnhgwhggjm{vxyfekkgzmjxhjxjex{fizjnlvnmwge{e{nnffenfxhnnmwmn{ekgnh{imhzyeiwlfgkgxjfm{w{enjyf{jyn{lnlhkkmmjw{ixhgjmmhikmhix{xegxnmjimikzwnhiegmjmm{{yexhzmlxffewyxngzfvynhvwlfx{xfmnyyyyh{xwfxlkiemhzkefiwl{jmnjgez{lzywjjzimfvgxim{lyy{lzhwnn{w{gxvhikxwznevekegjgxligyfjzgkzzvlyfekevkmjzyfex{egkimhgyl{zxlvnfxfmhgvjzn{l{n{ywyjkxfm{zygejzzvjzfizlhv{lggyjzzmjwwekyjnhexxhjgkmgxjekinyzfnh{ijvfifizvii{iv{njnfwjyfhzjmyhznwwylvfkgn{mj{hn{zlfzwfggz{emhvjijmhvimyykkjmzxvwmjy{gexhxlhi{wmnwhhi{f{wmnw{vywwvln{fvnhmfwhz{jziifznwhk{ggggkyhjvgmikwwmwjivhei{iyyemhkiknhzfje{hjiyf{fnykknfhmieyjmlfknykgzhgg{gxjjghm{hivhg{xzjeggxzvnh{wxhjmex{w{emh{geg{vhizw{yjgzwjk{yjghxmfzyxwgxhkjgnfzwjgfemfxf{ygimlxfjgjvhmxngvixzzvyigmjy{eiyjgvvfzfyl{xginwivxf{fiviexl{zmygizwzv{yznkgvfz{gefkzxezmy{wjvxjvjhkjxkkvwznvhgznf{hienfznjgikeimln{jxexei{jwln{jz{{{xmnv{kmfievxhvyhgwljekm{{zvfvmhvywlz{xyje{vzhylhveevfyyxjznvfkmeknjfkmljveeixjzwl{ihezlfvz{wy{levmwznjigk{ifkkezxvn{jwn{yxjm{zyhmyhjgjmgmgkmf{giznlxjnhjkn{fzzlzyml{yznjxylmfegzyeknyylevmhzjwf{mimzwwnvjvlxwkgimznnwnfmyhxjkjxgihz{xjmgkzygmemwhmhy{znxhyfwl{kz{ivhm{lnn{wm{xlyn{xjzhzezgmzzhzgzzzhkxygvfefeikeefihxmljivl{m{xfgyljmhmfkvffmwffmyhw{{jixge{hz{je{ymhgmmyji{e{y{njvhg{ijmy{m{iivjhmyhw{exighzevzykiikjkimjk{xmhnffm{nmj{z{yz{{xgghmjggzkkixxlzffemnnyivvwevn{zwv{ix{ziiyl{fhxylnjkin{zzemyjkigifghxwynjjkizwfnf{lxhwfjveknlmlgx{{nymhzwvfgkixzw{ifevyhivfy{hknjik{{jxyyw{zw{kikixxnwlhk{lgknhhgxjyfez{yvjnhjixn{evfem{nivevjizx{ghm{hizjgmjgknfzhxljvgmgvz{ywhe{zkijxzyn{{yjkkijmkmhvmjjk{fmnixjxjgixmf{ggkjewfkejx{nzhgk{vzwgzjehg{gwhn{ywywzjgvix{jfmmfzl{lfkxwigmhfkzwvy{gmlw{ee{kxf{yjgiifmmfvfkmkkm{wlmnzhfvgv{gnwwfzzkgiezjfgwfmhgxem{yxjyw{znynfwyw{vwkigm{v{l{gzyzf{ieeiey{zlvhwwvhnh{gzjfgjkxlevivkmggjgvnmfhmkkml{ekkjxkkyfivivnjzvzzwygvivnffvm{gxgzmwmnzxfmnhxfm{{k{wexfkkgiihkignj{jjzee{xgvxjx{{{mjvjgkjkfzvymljijmhmzxxnnh{gyyjin{giyjyyix{gyyvyjvhzkgwyylimvwzvhkynzynfy{zfimhv{xvwxh{fnwzvx{nlw{njnhjgxyx{jkgikgjevwxnikgijxjgzxfkmfw{ywkehzhiyngzzzxywhjmywxnjzvfvwfem{{{mhzffxwyxj{eiefmxnieegwhmnfvmnnjxjnljmyjmnyyigwfm{zywfzyv{kege{ev{mjjimhjxmjwwekhzmffeei{y{xzn{yhzzzgxnh{i{zvffxvlgxegmnnjyyz{{mhzjmgzevhkzwvfylnnzfxnywvffzwfgg{xnjkiynz{{ygigxzyzyzxvwmjhmexxh{hxlegwjhzm{kex{mnw{vnnyywmnwyn{{y{jfgvny{fznwx{myggmwyhzjw{{hyl{ghzggei{i{vxnkeylxfzxxnjxmwjkggnykknfnnnhhkeiie{wemzjjmhmxjjgxyigfijixj{f{fmn{zznhvhvmlvhyhhemwgmhivlzvxnmlynwwkiylvlxyyhvnei{ihk{wmy{wy{{lnlevggvffvigkiml{knw{hxwzzhvjmzfeimwgievfknnimhejg{vnj{fvn{jfziixlevmnvj{ezyzwfkjkwhfvylzhwwwnkmxwxfm{nwfinjie{kivhzezzlzyzhimxf{{egjkyfw{z{njnngezzzffmzjegkgnhwlwfxfkmjmjenyhiemixjzgmgiezikvngemfeiywjinnwwgxhiv{fkznwfnhjzylge{kml{hvjhkkgemjizfemvwgiivww{vzz{mfkvhikezke{mvwwywwik{fw{{hgxwhvfmyigwyn{hikmzjvynjikhmzyzfwlkmeximegyyhk{zfkjemhemjkxwyjmjik{jwlhmxfexmjn{{mexwykmxj{zxj{{mhfzki{gznyh{ymnjinnmnjg{xy{fvig{vixmfkmfvikzlkiwfkkixfenhgknlmfyngvixfi{xynvyfzjiznhxfmkkgkimx{xykev{{f{{emeinjmynlgvmnhvivgkmfvhwfevwjvj{mivhzgxvw{ezzylx{gxy{he{ymjzlexfiex{nzfyfkifm{leenjkm{znnvjjghxkgxyynxjjg{nyl{wnfkijeeggkxl{zhkezzlgegzm{wjjgmnvjxhmjzzfezhvfvjm{zlvl{nwymnkkhkjv{xgk{zeeeew{hezvzxwjnhvhjezjhk{mnhfxvnivikgg{zjgjezv{lzveefmez{n{hixylexzhyn{hfxfzn{ylvw{vjxiefihxvyyhfm{nylig{ynhwjwwvjixy{{h{yjgmyhekknjmlixjv{mfkjx{fnhzjnljzvy{lkk{kn{jvvwz{jxkkemnlxlmnnwzhkmvjgk{lie{ygzkkkgkijeylikhinhfmjexyiin{{{yhgiwlhkmhiinf{wwfxjvwzfjzgivlexezfk{njk{xv{jxfgezfmxwzw{kyy{nznjxjkyhfejmkgzwn{gxjigvxjkiki{xmfmnjvmnnlynvfwlzhjiyffzjkgvvywnznfgkkei{fgzgzzfig{njxnjez{vyfgmjgiige{v{gzz{yekim{vyyhm{ezxizjz{jx{kiznwyvnkiiezwzxy{vhnnjx{jxljzjmgvnfkeji{mv{hgzwfivhzl{{egwjigzx{f{nikeifkizhzizjg{iwy{xeeem{gfgzhvnjkvjyfy{gznygghkjmfxemw{jvimxwfzixjvz{wwki{{mffgmj{vmyheim{z{eylxweezvekvwizgxhmfihmz{nh{vixyjjixjzzxyvjnwkg{wiejgmffkyyekmn{wiefkevzhjkx{kmmw{zvfmnhimnimvnvlv{ien{ikwwkgvfwhjiwhevvnzljkwhxjm{{igmzzyfkk{jmnwf{miijmiekmkizjmh{{{xmygekemwylhinyzlxwfikkyyfvzh{wvjgijvnjmfnw{h{xwyjekkjinfnyxhvlikn{gmfmxjzlgixhmnfkmf{ghkxlfxjxfvnyvfnw{{jzfifknw{ezfzxvfnnexnlzhigyhyhmn{jv{emgxikn{zfkmjzkgjx{evh{j{eylemmhz{eezzgmwl{vexyjxhiinfxwgkivylekhvx{wynyggiiylgg{mhx{{{w{h{fivmwz{wwkmhv{w{exlvlxhfmhmzfzjkiznexzxjkzymlny{jzyhe{{y{kexyv{ie{{mlyyhgkihkegxyiknhgvkezyhxhxywjmnlfiwlmlggvh{zzjmnhmvnxlhikg{wgvvhhxvlwjzxyhemxnzxwn{ikkxwjv{hke{jzzyjnyvniin{hkjmvf{{jgkk{kgxegmy{ikg{jjgmnkmjxvjhkm{{mgxgzzwixhgfinymfeizjkiegvyznyhynezmhzyzjzwhvfmylxy{gfkfezzy{{kmlv{nnzxggyfjzjzzv{{{zemz{evee{khkkizhvwfihvwjjmgk{jjemfik{jnjywylgiy{{k{m{nhenynhfzgvnnvjyniejmvyzhgmnhmfyjmffefkemmyegix{zwnzngxevvhxjhkzj{yke{yvyyfjgz{wwemyfjmzjnnnhn{kgxly{ginfzjkmhgz{{yjimymhvlhvzfegzlgzevyyiv{in{{{gxjejxxwyhwyyykezhvymlggfvvhfmzhemkiexjgzlzlfkmyylvljg{kgefxwfigvynyv{fixwm{{wnhgmxleemyzvwlmnwwhgivvwexjx{{znynyjvh{mzvzvv{fkmnegfexhxyez{mxymwmywjigixwlwfw{zjhewy{yhmhev{{ffxywwhigekwj{nzhvfie{z{wyyznnnyhgi{{vlyhwjmjhvhxx{kin{fkkgnwiimjnjhxgk{ljefijigikehzkeyffgjizlexjgiewyylzfzlfin{{lmnim{iv{vyjxhkyhyjwl{{iiimjknyimjm{{mfzjxjimex{iwnivvlx{jx{lny{nkkwjignfeenlnwkkjkggyhex{xyhikjg{gjxemfzgv{jjv{xx{mj{n{fezhxezkiyfkkvlmlx{zykgkkjxz{yjnwgxnljveizvyhkinhfihgxfgzyniv{ffgvfmhvwgmfi{kwnmjgk{jixzxkgw{fznyhvv{ekxwkijz{ywwjghm{{ylfgvyigznn{gxgkhznhgxxlv{mynfzn{yynyyjv{zy{gmkeigy{zn{wjvfiw{y{emnfwwvfkgigikfmvyxfiz{fjkeggiiv{ykivfkkwjmf{geigixnfxznxy{{xyhkevww{yfemhmf{zzyfvfkvhkg{iggjvmjgm{jwykeiiw{njjkwyevmhnlzjem{{hkexfzzximnh{xhxzjezkemlivhxjvfgwhzfyhzzwy{exnmlnhzlzl{n{xvfvhzzzvwffmjv{ixyhekewfkemnmngzhxmlzhggxhmffkmjhv{hznxlzxex{gw{{i{wkkwjznivgefizneen{hiylvhezyy{xvhfgigfejivhnhfgmjhen{fkfemnji{kyww{{jjvz{n{wygevh{{v{zf{jvfwh{ngmhmnn{gmw{i{nfiemikmffv{my{fziz{{ieyhgxxh{mm{jivjekjgkeemji{kjeemhzfexjvykgvfje{leinh{hyleixykgz{vheijkgegviizvz{{{ww{zyl{iezzniziizy{mmnjg{xfm{xfzjgmhgkgxjiexnn{k{lekjgzlylmyynmh{lzviihmxjiivh{gixexje{lvlgv{xwjgvekwygzmwwfwwmwkggzjghm{kfiiknnhewyvyzwhgkknwkizfhgixhz{{himnn{jkhenj{xzjxhjk{wnn{yxhyheizvzliizfvfheiijv{x{vhkzjxnv{zljz{levylyymwnn{wnwzvyy{nzf{xevhgnwnjmlhxkmevzfyyxhvjxfmhiimn{jmyywimmnwnexwyvyywhvzyzh{ghgge{y{njkgehimjxnfmnjjz{{fvnjeemjyjjkv{wnwjmyegmy{ifxfmjgnn{nx{jmvyekmw{vyyvnyf{hkkznemnjzhznhenjvyixigvnjenhizhvy{hv{xgiekizfkwnezemmyzxxh{em{vwjgzxxhn{{jggggvwigkmm{yy{m{jnffihvixhmzz{yxjmwnhhkmj{egizwgkwjiiw{zzkizwxffzeikehinwikxwzfznzzx{zvhkgivyjmhenhz{xwezginfjgjkwjnyzjwhje{vkkwfylyhegekyhixzjkg{gxwzw{izy{f{nivvyxhyn{lnjiemnvnkkzyhzjehiexggwnfxhmwlhixln{eigkmhzzhxzynnnyfeggynkkjvyhhgyfzw{lwwexvyievjjgwjwl{gz{jmwyz{ynvygvzyfi{jvjfznljenl{kmfivyhylevfem{vwzhzfvnigmhzfgzm{{keevh{emwnwwlegimfi{yvhiiikfkfzggixii{hkkvjxwnnfmgmhvm{y{{vjgyyjezxfi{fmygvge{yfm{zjiex{zfzzwhegv{lhv{lgkvj{jww{e{yxy{wkejxjzzf{jxjzv{jge{lhigxxnxwfi{efg{fhkvyemiixjxjegfewhizynzwkevhjimlnlzygxfiv{vwzvjvwhmlxfwnighzgxyhjeyh{ymnzvnfex{iyhfeyyzv{jjvxlfkhkxjhgiiz{zvjgfkjxz{vnznxlkmkgn{whzjmwxnjvjgfvmnylwjhekkm{{lfmimvlzwvhie{{xygveieximnf{{hgvwhmwjx{exvwmhzf{iggzwwfyn{ywjixvl{{m{wnvnm{jgmlmwmlzjxfyhx{v{ienhhgizvlhzzwz{iijejmgemhmymynynl{k{f{wzv{m{jxhiiyh{ygziin{x{emjkhgmfjzvnhvjmnweggzwwhv{ghkiejgwfnfgivlw{{nzlgzzzwlzw{{{vivywzzjzvjekxhkmfxik{kznmlgm{gwlkiny{jhmggiizjegjgzwjgjgjemwv{iimhhkvyyjmhhkgzmn{{{l{vwlnjzwxw{mnwz{zfmjmj{wml{vmn{viiiiyhnyzyvl{j{vznjemhee{ezxkmivzzzy{kylhgzxhmgk{lzhn{{w{mmfjekkx{fe{f{nmweikegeyjy{evemhvkgzl{em{zwvhxfynv{egjivyfm{z{ezlxfzwegegxj{i{jhg{evj{keegkwngikmhgvhyyfzv{zxezmnggzwzx{gmhfiznje{{{f{xnf{higfzvwezhzmfeizywnwhvl{nge{enl{j{lmyvwz{xhfkhvvffvwlemxfgmjkxwimnyv{ywywexevzhiiimxhikwn{yjivjjgezekvngviinlz{jkwlnhivzzvl{ikmgmnhmwm{yjevznekzfekww{zmfmnvjfmzhgvmf{zz{{ijgmhei{hvlxfhmywhvixfzzn{i{{gewfgkyjyhzfylhzizjizlvjivx{mj{yggiigivjnnvfkkywnfkkkgyhiezx{xzvgevwnfnhkegzeg{jgihxkkvhizjzvweg{ykezvjxizxlfvhi{whexjkkhix{eehkxyyjfiikxhnh{nfmnlkew{vhegyhzvzyikggjewnvyvfmfhzjgmhie{ejekkjgezjkvywh{nfm{xzfkizwwyzxizxfhzjgikxjfx{vynnjwlimjghenym{nhvweewh{j{e{j{vnjjmmyjikmfvzwhkhxgmfiegfgivjimfzxjxkmggeixwgvgiy{ixxhgiekizzzzyvlyhvw{eimyfmhvwxwzxxhzxwyzfggzhyhei{m{kiv{jnffigxv{eghkzhvwmwnhiiyhy{gizww{m{ikggeinlz{fgxhnlkeznnwikfg{l{w{vhxiixymjwffmnynhz{ikmlwyx{wlkgzjjxzfznzh{vkkfxxfm{nh{mxfeeznxnvfznzw{izykijxigjvhknlnjizemiizfkkzyhvjmhmexggjekk{i{h{j{en{eiw{{zvliejkhzekywjxvlixjvyhhghkzxzhjiexiew{w{mywjvy{gz{{wyjezfv{hfkwwfxzzwyvlnljeeemwiezn{m{hyymnjeiinhkivnigxhimjegmgmfe{zevn{nnwlegimgkieimwh{exhyhhez{eekikkvjxwev{jxjkevjvnyfylxjy{vffi{f{hmjiggmny{hmjgx{fzv{fhegvjzyw{nwnee{jmh{i{lzv{hkejx{jjejekehv{zvn{gixixhgxwfi{ehz{fnhnhemxnzwxfylv{whizynzwzlwjgxeezvee{yieiennzvjvfvyjnnvl{mivvhgzzxhivh{nzvnfex{vjvywzj{kz{{vznvlzzxjhgynfghghzfznhynzyjxnhkikgn{whemwfxnzy{wwy{wxyjvmhy{m{{lvwegynigvhnwnwhkznvliximnf{{{gv{gzwjgvfmw{w{{nmfggzwwfimzwegynfewwmhggm{zv{hmlmwiivw{vixgxjenyvly{ikfvhzzwz{kg{wizgezxnwmynymnnj{f{wzvm{yjjmyniewnggvjemnyjmjkhgiigkwnznzwzjywzyvlznigfkjghewneeikwnex{mnyiinnwyjgvjemxlhiwh{gfgmhwwzlfkznggjen{zjyfzwhzemixkiwnii{n{xzjjgwfjz{wzygev{{nzwxfgvgkfvmlmlighxvlxw{znnikkkfi{jgm{vnyevimgkwfhkywyjylzvgkegjzgxexfxhkmjy{{mjveefzjznlnffe{z{z{ikgxffvizjvvnznmw{njgjxxhyhnfxlfkvlzhmhemvnki{fxygzgmmjxyynkkvwzlvjiigg{{wyhkxjnh{ngzvnxweixjik{z{kfg{exfz{jizfz{emfkvfezfvexhexjggnwmlzzjix{jvyyee{kw{jxwlwjevzvjkzywn{fmy{jwfzvkizfee{jw{hvkggzjgfkgzz{{veinhfmjghgixfzfkhgnjfgjk{hzymjx{wlmnmwmlexvfy{{zzzwwievfkghgxfxjxyfxjzek{wnjhxjgivmyezfkjznhgezx{x{mjmzvhiivxl{ewlmjexjvnhfiyyzxz{vfhzvfevjijeiivnvjwlvnynyjmy{xhz{vhxfmwf{khiznfmyhkigziikk{ynlnynfvwyfhkzvem{jjmjv{gvwmfxw{iigwlyhekn{hmjz{lyyxyjzfixfwhhx{w{m{wynhxmw{ixjnl{x{xjzwyzzvjxwivwjmlvyfenwz{hvy{zyn{zffm{e{yfmxjnywhmfjiwffvggjg{fjkmnwjnyvw{nivvjnn{xikfximhmxjfkvfekhvkiixiiwnz{{mjk{m{x{zmynwvw{v{lvhvjmhm{mwwnwfkkhzyhkgzfnnjv{fxwhe{wjzizfzzjnheijzkknjexexxl{j{vgenyww{zhexhyhm{gi{wnywhnffzjkixmhxyxfwhmyjm{nnhkkzhznyfyy{ivjfvy{ixylzwfen{{ljkemjxxfhkz{{y{i{zix{hmwzh{hzhxhgmimee{x{xwf{hmynyzlxjnffxvyhzfefxnfjxzykinjjxvygzeiezmy{l{j{v{kemxhjikgiinhgvzz{giz{zvwje{vnl{jjxivxlwfyyxfjmzfgehmjgml{{jxkgwfwyhmnjgimh{wjekifmvy{hhkzygx{nzlnfieienlmj{jixgekkezkigk{mxlmniezxxlwfjvhgm{{ghefkyliv{vimnhvhx{hzevzykkginhim{w{x{zjmkijvmj{z{ynligmn{hjehvylfmkgzfemmnny{f{nnn{yhkyhgeeefexy{fhxylnjvnmfznhxyjnyyh{{zfjxnjjkzjx{xn{{x{vhvweiizevjgfknymhzyfgfekmgg{jfknjz{fmy{hknjhmii{ywlfxyj{xwn{jgvixhk{lgkzwxwy{yhfvgxnjywhi{hvjvfemekwwhvn{{zwfgxhzwwjinfikv{im{mjvyngvjzwwkizwjigknj{yemhky{hkwfhzmj{gzjz{gmyfzvkizznlivgxnl{jvywwynegmwhexjxy{n{jw{hzev{lfgmyivyjgkxy{fjvw{xwmhizfvwfginlnnnjwf{lkmemhvyyvnkg{nvljvwfeziz{kyfnnv{nnkgiefmhvizgznjkkhefe{w{{ywx{nf{kjgzyevjkekhv{ygem{nfmyxniifkizxwzj{yvwhm{hjx{wxjz{igzfvyeenwigxwvhyfmh{{jxvlnyzlmfnfmyzwww{f{yv{jmnfxjxh{gmhfgixywzz{v{v{wkgkikinhv{gxevjzwjkmm{jevwhikimjkmfvnhgmml{zmffzx{em{lxyimiizlmwjixwieyfekgmxnje{mjmw{n{gzevwnhkyjhkhkfizzywhe{xjg{{eiikhzhxzfzwm{n{iejk{lzw{fkgxlvw{ejgw{jkjxhike{jwyegvh{yxwjzzywwxyxlmlimhijzzjvlyniivhvyizfmkgnfggjzimhmyhnlgv{vww{vmnfgjv{lgeemw{vjxfvfivfzhkex{lzwnnznxl{gxyzlxffinfgkvhmn{ekiwj{{giim{vixhx{xixge{xmjxjnlkmvf{mkimnzwgkikhizjwnfixfgkvhxwnf{wfzwfgi{mmwjmyfjx{yvfvfmfwhvfvwmjfmzxmwzl{ziv{zhvkkzf{hmnw{v{vnxyhzzvmf{mki{xvyylfznwhkmhvwjm{ljvimiziiwffgzvei{ixh{lmfizvwnjjg{zmjvyjinykknf{iivhkimfxnfmjmjkky{xjjgxyhvigjiy{evvhnwznfkyf{hmlvhmfyywwmjyhzwmnzwx{emfkkiylvlivyn{gjmm{kiggmfivzh{lnlvfhzzyfzvhzw{zhgxlz{vnvlhvjmvnxh{{zfvjv{{vhgfmhmhznj{fgifmfzhgmleenhznwnjmivfkjkfvixkkwfvjwy{ywhkgfzxhfinjiejgfxxhvl{xfmfxexvhge{ejkyfnhivex{lkgem{gv{feyyz{{{kggmxjvfhgzykkeekm{hhmienjwlwy{hgg{vzjyhgzgveghegv{wvfgk{yx{wlmjw{njegizgz{givmhmjmfwwznevyfww{ikivlmhkizxwjjmmlvhxjmnznhennigkkemzfix{mizxynlnfvjegwnke{xyh{nx{mwgxmlekzyhe{ejmexnnvlzlxnhzmhmlixvlhkhkhxfeiix{fzywjzmyyw{m{gjkm{zn{{mnylnyyhzneikkwfzvz{wnzykeikv{jmfxzx{lyyjizygmmhegfvhzigmyeeimevyweejvexmjyhvlmjwffzfmje{kww{hfgwjfmnhikki{{vjexjmfg{hnnkgvj{w{ejgjxzjzyzww{m{wfmjfmnyjvxjnln{z{zwv{ikimxlzfnwvw{ieevfivzhivemfxxwjgmnyj{whvxfhkkinnhgvnizzyxnzwxyxjwnvnxleizjkmekfe{y{{nfgiylezfem{yh{nylwngmjenlkezz{gfiv{jeezxf{kivzx{vginw{{hk{mxyjkfi{lzhhknjxwggzxfizfz{{xvfxn{evjhk{lgm{xzn{yjkwhevyjmnjxxn{evfemzynhikxnfgez{mievfvlx{ikv{xyyf{{fmnjmyzzmf{k{mkgnj{yemylxwhgmyjvmwzhegjvjvhizvkiizekwhxjz{ixyjezivjg{vhexjxnmjynjzmjvfjgiviemhvngkxy{f{fnlhgeewwxyw{vy{xmnekzjm{gvmwyfgxhigekmfvv{zfz{zzfxjk{v{exlzlmnvjzvvhfijvemwlkmynhz{niigzzvwykemnnjgmnj{nzjzjjgfiemvnizxjvyfgwjnhxwfm{nfzhivnie{wwlkiyfzxwlwf{iezyw{hvwmjvfmhmjmfnhixmjmfjxhzhkzf{nkknjnnwwxymnzxy{fzvwzwjznwwj{mwn{zhggg{mv{xwnfhewjvjfenlmjgvgzmw{nikeivwnlmlkmhvivfivjhkhmkkfgzhvnnjvywfnlxjnngghkwyxlemw{{fei{yexvwyjzwfmkixywyfgmj{v{iwlkkx{mynn{g{g{fn{gkizgxhknyhewhnwjzixhgylkkzvxyvjnwmy{{gzfemf{xhizzv{zx{jfkevizfkzzjifiivhmvw{wigiivnvlvf{y{ewfvlfkm{igekz{wnvnzljkzwzzgg{mv{{evn{xhgnw{x{miiznvjzlkijenyek{xmfivkimwyligvy{xzvjehvwlgmnlfvkigijveeeinyznekgixyjgyh{zegxhvlik{yv{jiylm{nfgmzlxfmnjihkxlegkkvljzzhekn{zykeggez{ezfmfzzev{yekylv{myggm{{lkkemgxzvmnizzngmzxnl{kxfzxkeylemgihgiihzfghvmwiegmivivnfxwwyzxnjgkjexnxjnywnjievjv{mhxgizhhkfvwhm{gvwwz{emfk{exlwlyhhk{jmyggkgmj{g{gjgzymlekkkmf{vywyhje{lwljkvfmlyyhgeeny{nyjfivwxfkenfxfiiywjmnhv{fz{ezyyhzhvhnfgiyyxlhi{nnlfemjvhivwn{kvjvlw{zxwn{izzvjm{w{eemjzzhm{ygkhxn{hkkmnfgximgimfeemh{xkg{l{jjg{g{w{hjkznwj{kylfehxgmhgfinynnnwvfkenjvywjgzyn{nevzyzjkizvx{ikxfm{eiwwnyylgkmlv{ei{kw{znxnzhnh{i{lfkkeevee{kivvffmv{feegwjjmvyzhjimfik{jwwikgi{nfvwl{i{xhxkknhfzxfezjv{hzyz{wljkv{ezjzhmmffeix{ykgfgez{hxfvfgxwjz{xjhkzfkigzhmfk{{znnlikmyhxjmzjein{ylkeywzyjvmlmfnyyyz{{yjiie{evwxl{wkmfvmnxnw{jk{in{jg{hxw{vnjfvfeyyznnyimmlggwfezfmkemjkmhvmhyw{kgvimylvljmnhvj{gjmvhjm{{w{vlxwm{{wfimjhkhg{{mhkikkkg{h{jxlkk{xhevl{wix{wnwzfmlmlfmeezjmjxwx{vywlmfkgxyynyfmlvhxjjggiynex{hfihenlwhjejx{fxj{mgiimzf{zkgkmjzhmwjwhxyfknlgx{zmhizjimwhmzz{gjkwwfivyhzw{m{{hjevjfkzhwlxfvhfkfgixmfiinwhmy{fxhgnwjgznnyxfmhynyl{jgkhg{xv{zfnfz{xwivivxhzzwjggxlgkyy{ihefxyjylgifenhhvggywjgkmwyxleefeegyhkm{gnlkmgzznhieemniiyyfzmnixw{yy{{higkzxxhzjvfzhfxxhwyznxhfezw{w{yhvyfvwyyixnymynlyjwyez{hjxiix{ekn{ggzyvfvhnj{zfiee{{vhexxhhzgmvwjgfmjkvj{ewlxwmnvwnn{jyygixwyhylnfkiw{mwjmfzevjkjeegwlz{nwvlvfizkeeejzm{m{{mgxjeikfkfewlegkevjnfkew{{wvnfx{lvyyjzhwljixlekjghewfhxkk{lhkzxyjjex{jmfkzn{{xlzxzvmygi{whm{g{vmnm{njw{zj{{hk{hhkgeggm{zhvfim{gjejiyj{y{igmezjzxf{ngvvwjkmlmjfkhmevjzw{mymhn{zzji{x{zvnxjnhgzfzigjzfixwn{vhjvmhzzixgi{lkiegmy{ygkfgnnfxxyfenl{fml{nxjevekmfivz{keywvlhxgkegvh{lyfynvyzzvn{hjmxwnhkgfxgkvyhznnvhyj{fynnlegfxgvvnxnjgvyjefmgvhiexjmfgzyggxjxhhznnz{ixgmmfvnwnvhji{m{gzvjxhvgexyimnjexjxiemwggwjywx{zfzhgejkkg{wzvhvnwnj{liiwwjiylkky{gkxwwwzlhgexfmjgxhnnynzfzjegnlxyzyjgnyemyjzy{fvfgejexhzfmwx{{gwjzlkmm{v{{vwfvngizwvhnyfk{mmyfx{xixjgwjz{{emhkiv{zfkmhgmnggzxwhfzz{v{xfnlemevhv{jkeik{hgzigmwxwnynyjm{imh{{{vmfemzwznzz{nnjiijgkkzlwjeieg{xmnezmh{mywzxemzhmyeg{zgz{yx{xyfz{nhvfv{kjkzyimhxgzfixfxl{{evemjvhzz{evvn{wjvnyek{ffmhgnlyfkkgv{ihvfxynwyjmmlxwnheixh{igmvyxlmhfgfvjifezhigexgi{yn{kkfxjz{iz{wh{zmy{ejehxwl{vwyxnnj{hggeeevxfgv{njexhfikknjjzjgzhhkjizwnfgk{xkgzyjikmzwiiznzzggizxwgzvyhvivfz{wxnjmwh{yimmfgxznzznyfzgmyh{kjekinwezzjxwgzxf{hwljz{zvngiywvnzhw{znei{wiz{fiegvivezzxxnevnnywznmjfm{mznfiyfkigzvwylvjvjy{zw{yzfvhyl{v{jzyiennyjn{yf{h{hhgeimlgvv{xhhm{wwfzjkimyemjizx{vgxkmz{{yznjxzy{gx{mnjmz{hgixjgx{z{fizn{vmn{lyhv{km{mzhgv{wyfzhhzjxzxxwxhnlevmjnwimggfmmnixgv{mzhv{nwwnfzw{kmkejkvhekzz{fjgzhzzyyjivhwfjknygejewjmlnnzyhkjgx{mw{ijmzvxnwwvyikhzevkijm{y{enwmh{ffmiv{zizizmlmyfmjmmwnyyy{nzljxvjyj{vnl{fjvxyexezjzex{hiziiiefzhxyjzzheemvlyfzj{jginjnn{hxjzymj{hylzhn{fzzyiz{{y{iznjzymhvjjvwnxhxy{xfkvnfevfyjivevzlyjfejiexjxgmgg{jhzizfgzwjv{meizwfg{h{y{vywnfyh{xfgzxhzwnzlxjn{ekwnxy{{gmmlv{jgmhjxvnjm{xjzwwn{ml{l{kyweznfhimnikjejz{ejmgziizvjghem{jgzwixyhge{ygvhzhvggvngzmwkkzveivynn{zhxwyhvnyjmyfekzwik{xx{vhzlywmnhmnlhxfifezw{yjxvfynwnm{fk{zfkjvwfnhvl{yylw{gvwj{vzhkeikexvyjxjmge{{fiwweiyneeggix{kfezxyjxffznjzyzl{lzyimynw{{jyl{hynjxemwnnyznevyhwjm{mhzjjxywzhexvjnf{fxlkk{{hm{lxfgmjk{e{kgz{mhmmweznfjmeeevzhgghigkeijxwyizji{gn{{lhikexn{hgvylfgjihxeihvvynyixxlylhzjivwiznfvjfxjmgvxjn{jkkmei{ljeiez{gzxwxwzfhmzjwjhgy{gkgi{zmyvny{xf{xywiggzwy{vjkfihkfmkmhimwxwznevxyix{mm{mfgxznjvynhenjmlhmjiv{{{fiyfxjmlyngvy{wyek{iizfzgxzhvf{vvnfkmlkkvygiexw{zwyjnlekzwjmge{e{yfejvvlvhfz{wzzvjmjzlzwm{gmywkiywwlemvjxh{fywjkzyhz{{{{xlhvn{zzjxfz{lzw{nig{zfzjzgg{fwjfgzvjxjmgxnfeigizjzyekw{hz{yjkwfn{myyfjm{evyjmzyzyyww{fxexixznjxxhzvgehkhegizlzjivnwjm{eemgmnfzhkinfzz{wzj{mx{zvvyixzw{nnymnkmn{hveieewfvhzhhxixhxvjizmj{gig{fjgz{ylmngvzxnyvnmlmlvfkgzlim{fvfhvvfhk{nwjekzz{zfehekkyhvhemgzzx{mgvvyxlzyhemnwl{inwvfhgxwjmhz{kxymfgzzlkmwhgz{wfgfejivfjmgz{{xh{vjgzxnwjggky{yh{fimhkzwz{mlfex{gkwyfxkmfzgzfiwf{hkifezlxljifevlkmgvzyezwwzfjkzwwyzxkmyhvw{hvnig{gyyex{vvliizjmyy{{weegiv{jewhxfnw{gevhzgg{xvnizy{xhxyezzynjzjfkx{zzvwhxzhez{vexjeyngvzzgxyjnyfgeizhezy{v{km{jhxegmn{wnjx{je{gixzhmlyhywgmnnivixjeezemvlzzhzge{wmhikgkekjkiiwwjgvy{h{inyhmxngkfgkijziexnggyjjeznywjmnwyhxhyf{{mjeigzhmgkixhmfzgggzzzgkwnhzxl{yezieyf{zgz{z{{znyjwjzz{hxljg{fzvnnzjhkyfvwn{xleg{ymn{wnnv{zhfixhkgjeiewy{vegzl{efvvlezy{nh{xikwnigigwwfmnwyfek{j{{{hgvmwgzmh{wvfiewhjizyvnfxxln{wynnfzgkwywlhiwykgzyheizgz{hyjz{y{gmmwvnvhiihemj{vgm{yjmvhzjynxlfvegjzfzkmhzevgzggjvfgixzzfkwyezvfvyhzfmhz{fylmfizixkkwwxhkefkhk{ygm{xiv{{{ykigkwyv{nhexmjzwjmzlgkiigzmh{f{hegwf{lhejghgevmnwygmigizzxjgzjzzw{vfemgin{nw{gylemvyzy{iyy{yjiex{ny{yymf{{hx{{jmhzzjvjxjxwmfggzfw{whmw{lzy{nn{njiv{m{hhxnfemkikgeevfhe{{mlek{khkyyfzzjzf{lyfjx{eznkeywje{my{vfizikfxyjkgnlnfzl{w{jeeyfnyznvnyh{fgk{xfggmmlgkee{lv{kewlikzxgxizjgvjjxggexgm{hjinhfmwf{nvnnnzymjzzikv{emjmekfmyhvfxwjznjizgmignykixffxjzfmmy{ggzmfkkvjyffzjzvjkg{gkmjggijgkkjgjgkgnn{wzljiwlwjhvmyfkfxkkwwjgxn{vwwiemjhx{lzfwh{kwwgevyhmkmy{emz{kev{yfimm{imizm{vynnmjzhei{m{{wnggjmhkgvyfizzlgmggyfjizzzhji{ngvvjxn{hjxxjhmfzznek{xywzvgxylzynnkgkinjexnyigiihe{wheexnw{mznezjiznhvee{xmhzywhnfix{zwl{ixwjzgxhenfimyy{ynjjkkmeehiixzjkgxj{fex{{fivfkkyjyy{xegfxvhmf{xgg{gmjhxzyhvixezhexynhfmjewf{yhgyheegeixvhwnwfzywhevwwwlwf{{jzfggmyfxwfmigwynljihgjemlfinfzjfg{nwjiihvemeeki{gvj{kekkkivv{{iieji{{wwfeiijmyl{{vlnjn{vyfzvfjejkzfjegezxiezfwhzjn{jmnj{hnhyn{fv{gezvivmfivmjgz{ykmhizhwjz{vnhmixw{zyzh{ngieeiixyxnzvnjwjzhekw{ezyhfgmlizjxnljgyngvyfgmv{{{vneiylvfizixwhhx{gznmyekzhgmzygijmjxikvfimzhv{xnhgfi{yhkxlmywyxlx{v{mjhvz{gggv{yzvhmhiivgmmyn{njgz{g{lyjmjgvjkjiivjgzhnwyfheyhfvvwyfmnxwkgmhieemvjmnzfynzx{wynnlzjwlhmhvfkw{hkfzhxeexnfgfvmnwl{ivyvhkejmwy{gjxmjjkjefzwnyhjmzlm{zvivhxhvyyjxgxjiznii{lgezfjezl{mgmfm{x{nixmnwfzwivw{{jfzyh{ekmhezfny{{jkeihvvhemhvzlvynhn{{xzwzyynzx{y{{wyekezvlmhivekzfeiw{jxjvxhivmhwlwffm{lfmgx{v{x{hvlvyevzjz{xlywmfkm{{myexxnhkzjwnyjkkhijg{e{wyjzfny{yjvhxn{{wzyfkxwnnxy{kievlhgfeyfjx{yyhyfexnyzwy{fmimfvwnzzekzfig{l{kzvmygxjmmy{nekjgjm{gzyznxhnf{x{fekfvm{xjhmeijvw{xlz{zxxwzyggvlwjxnxfzxmfgxzlnlwnxwjxfkizwlzwmh{hikfe{nmwnjv{kk{yev{xgvjmkmyywl{hexfk{ffvezfkgixyiz{e{yxjjznjkiyfjijvvnezzfzlkkfzxhgv{nzh{vnwwwzfjk{leknwxfjizwzv{fhew{fvmngvjvfgjxegmjnnkkvnjmyn{{feegeimyxwezeinliz{izjvygkfeezmhjiv{ei{{{fjxgx{yhkzhzhwnzhvh{{v{jg{hvjvykemlhznwvjivhkkmmyjvgzyjkimjvw{whkkg{xheeeevemfeyyyjxyyfhzmwwjywnnzxn{{vex{eizjgzwz{imjiimyjkkvnyyyfjkmjyhvlvjhggvekigjike{knwfvxfhmeemfzj{wy{evzjxym{jeiexlzfmnxhiggeeixw{{jk{wigxyhz{vzzjvw{mjimixkgyn{ejikgezjkfgez{hv{nnxyjgxhnlgmhxee{yw{zzwfyn{ykkgkmyhiwfz{ezkiwfjmkgxfgmjiiegzhvmffknwv{jvxhzligixeiyfkikejxez{lzjjz{fwjgxwhnlvjyfzww{jgjgjxmhfeemzymhkmivgkwl{izv{xfxjxmlzzzl{jfkyyggfzezgizzzlywzh{hwynfzjhgn{wfjievmlxhivhigmvlz{ggnyyjgxxhvnjmmwm{jenfyhex{wikeixyw{iizxhmixxnzxhxznnjfkiz{fznvlxwy{zvynyynn{kvwhv{gmlkmgzezv{zjjxjennikmyizfkzvmj{zgxgzmyjzmy{gm{kgjeyh{iylnwwjxyegnjy{zvmhnn{ffezxnw{n{ngmwfjzgvfi{vhmimeijgmhgziezlfgyyfvhxxhwnzlyl{hyhkkhm{ikg{knwnlezjvez{iznzjvnjxfivjexzfxyizmfv{myfzxywyzhww{zevmj{zhexhexivzwxfgvimmlfm{nz{fi{jyjxlzwvhyfggyjzfywnwixzyjggmnnfeegwjzvegywiiz{evhexjhmgzzlexigzykixhex{gmfzx{gzfmfw{z{whyhvh{{kk{fnwfmeeyn{{hv{mvlki{zxljg{nxlfmwjgkhxjvek{iggwfgk{kizznyhxlx{ixyhnwiz{emlwfhmkk{{ii{vmhzzexvy{xiiznzn{lmhjvxhjxjkhi{yiznwmngvvfzy{ymyeehxxnevm{hgzfnhhxn{xwjijxzwge{yzy{fizhenwkkhzhvnyfexnwnjkxjmwnjhkzxjxxjynzyxjzzhg{yhgyn{wixxfwwzjgivynhwj{yjgjimhmfgxfijgzjmngikgxffxywvjhk{yxl{h{yvn{mw{xlmwkkx{znxnnyvlnwxh{mgxjikgegjeylfiwfjzkefenwmnz{{jzy{hyfylvfzngkfmv{nn{iwwznjgzxzhhg{nixjmhiylzfezgxevxhjg{vwwkmfzyhnjkmzlxnkkv{{hmykg{ygeivex{zezei{vzxkikevy{jmlwwhkggzxv{wjhvexezxwgmznwljmyf{nyymnzwyn{vvnjz{x{iy{zn{vgmyyyfhvxlvlfv{ekgzzvjnfemzjggywyjwhx{jiww{mzvvfvwxlx{vyzjx{zhmnmnn{{vjmigzfgkhizlzfxnxnzyyf{mhzkkxyig{{izywx{z{zwkefzjkkgzlkg{ggkem{vhvvnnfzv{wgkxhixjznwyfxhfijxmjw{hvigw{jm{himgeivfghznnvlvj{njzxwizfejmhi{mzzwf{yyn{{yhvwzfzlxhzlwlimkmiznln{vwfgwlvn{izzynwjnnmwwhxnvhgzzwjzxngg{vgx{nggznvh{zgghv{jwjmlyj{lfe{gfmjzzyvlvyxl{jwwgieg{h{ngigmjiiejvmjvh{mwwnlvhkmzxzh{leefgizkm{hxhvjwy{jw{eiizxh{vy{zhwlz{ikvwxfmfhe{lfz{l{lyy{hhv{hmwfxw{yhynyh{vfxfgiezzwfyfnyvhgzzh{y{wmhfifix{hijmiiemjmgixhyffxnfyhgeiezn{wjkznzy{gjkkiywnjzwnhixnl{jiznn{himxnkkvjznhkhiz{{fhmyjivvjy{{kjkeeylhkgmnjvjfxigxjimmhywmnxyyhyyexvfwlfi{gxjfggejvynfexyfx{lfkvl{ynwgkzlwy{zjk{jfxhifz{evwznvjyyvjgxkmy{jxw{evjifxgxmwvw{lzfizyjjmyh{zjkgzfmivxjkkfghz{xwwfgjxwlvwyjn{wnyhnfezfmjzm{ynigkifkge{{iiznmf{hwlkmiihmwy{lfmemezhxmnnymj{xjejgyyjm{xnw{fyfmn{l{jnhxjgx{lzwezmnjvx{xfxlizfz{zev{hyjjmvlnlwyeizv{l{hgzxynhyfivexizhzmlvfywz{fzzvzfeiignfkefexh{jeexfhgivml{ezw{jhinwzywfxjmjz{mj{g{nzyxlynjzzwwhy{vlx{wfyjjkzzmyfv{xxhgvjzvwylnjxnfkeeekyffm{zwy{lylxwnynnfkfx{hieig{v{j{lfkn{gzgxyjegkg{gyleghvnhexhijm{xxwnhkkx{mn{jmfwhhizffihzgefgiekmeefv{zkgfmzlxfkmnlkim{zn{jyyfgnyhvv{ynvwiivw{{jgzvw{jgimfiz{wyjkz{imjiy{igmywhxhiezwv{kmxlfxiezfv{jz{vzhx{wyfvzf{lvyigkmiiexzhn{fi{wvf{lv{{lhefihigkvwjxjizxvjgmhxnhez{nz{kkiknjhkik{mzfyw{ifvhejgeiyhgm{lezjmmfwhzzwyfzx{wnwjz{hkvhzhxljxivixzvxyw{mfhejzvwmnv{yffzixjimlkinl{l{hmnwliehxmnzvxyw{zlvwzhzyjkikzhikwfgxkm{xzxzjhg{en{{whxgxfgfvwnivgkheznhgzxfkjgwwwfmheennmnkmjgwyzyixjxvlzyfkm{hkfv{{{wz{jxhkkeywjmylienfzyix{wfkjmwnii{mig{wmnzwegjivfiexlwjexhxfk{gexgzekixz{fijmzzvjzn{yylfzfzezieevhg{wv{zwekzzwjhzmlxlv{w{ekvnn{wh{nzx{yheemggm{nwzfexjz{ejgwlnhjekeezny{eggxfgg{gjmjgjkvyee{gikzwyfvln{{enjxw{y{{zxvnwjhmzzikfzvwwjvwyy{m{gynvwzlxljgz{nwzxnnimfgz{vwxjienh{nhijgkgyhmhvyyyie{jjehxixjgznkgegjzmwegv{xh{gmwnnmjixzvxhyfyffxixyjvwzl{{hxgeylmjnw{wevylnfkenhiezwhxevevvlhx{vhvwj{z{ljvevmwgzvh{wz{kimhfgighvzyixzwgm{mfmjxnnyfjmvnxfzny{yhxjhzgmwjixvwnlhegekmx{nh{k{egmwlkew{znzj{fjzmhnhgviefxzvxwyhyjkkzjmfemv{mhzlzjezhgnfgxyfyfgvylfmzlmyfxigimmjgvfznhkk{ifzgegihk{jy{zhw{zhggvfnnjzyyz{znvnvhmwwnxhigjmgew{{lywmfjmvw{wjifvkefgnwimjxyjxhwyzhhx{ghx{nnfwwywxhnf{h{z{f{enwjkvyy{xwge{zjvgmx{{wfmmfhmhevnjmkm{iimjkyfjkwy{m{zx{{ymw{vmy{hyl{znngxwjiznyix{znfggyl{hzh{wiefvmh{mfzmnegik{hw{gkiiixnfegny{ljeezgkeviijiemnwggfgjvnjnnfiwf{kfijxjmjgz{kkkgzhylezzwvnzzhznnji{wezieivnjw{mlivhkji{zevggxfxlgzzvjzw{zjwj{fmfheeefzxnwlhxvfwhnwfkhgizevnnjevnhexl{j{hzwvnixgvmfigkimjnjgekm{ynhy{mlhvjxkmzfmjwhwwfijxfm{vkk{zfzvnxy{{kgjijvjxzyn{yyezxynymngkgmhkxhgxylvjznwjevyygihzjzjzkkynzjvfjihgji{hfxw{y{emnwhifevn{hizexzyy{nlfzhkhkylww{vxwgiign{nhwyhmmn{egzx{kifvnnzjjxkey{{vfmgviiixekyn{f{hgzmfw{mfxlzvfgkevyiivjfihvfehvmyyn{mfey{yymy{fvymwyf{{n{emzwnygegxfivyvy{ffkxjvjznwygifz{wjkw{jezf{vv{ixkeeejxwheizl{{{xmjvl{jkemjem{kizfegigezh{yjkm{jemy{jgewyzwxynyjiz{zjmfge{wmwvyji{njk{{fi{h{nxwz{zwgzvjvyimmyzhkk{eee{njz{jeefevfxhznikjveekiwyhex{zjn{n{zxjmvn{eyjfznh{{fikgnnxjyjkggknjvnjxyffxfihkex{gwfgen{{ezzxn{yvlhz{lwfn{zwggjz{yx{gxjzyjzngiikwym{gmkk{ihzwjwnjzgevjikzf{xzxjk{hfxgv{fyfnhkmgggmznixhihkighgwfnny{fkkgy{wyzy{yxwjzmnfeeijgxwhzizfvjgvnyfnl{m{i{f{ffg{vznz{xnywynkgegggjvyh{hvwznfegmfxhxxnfi{nfvgeemxjxh{yje{{ixjgizvwzzzljzylmlmjvwxwexnhkmhzfzmjkkjmzfki{yzxxfzhfvmyjzmn{wzlimixfxig{kjixhkiiigkwhkkexhezfemxwywvn{jwffkkefgzzzhhvzhnjkkhiznywvjgew{fmnl{{my{mfxfvhxvln{iz{hn{zfhvim{kiewnwjnywynlvlz{{z{jwjzhhghkmnzjyjmwfi{yhk{{ei{n{jiifijgwlighivfjiznevnyxh{kgvegwj{ymlexgzjxzxvlexjkjikg{e{hvyegznfzimgz{mzxyl{gjmkeegz{hzji{enfnhgxznzngzemwfxngvhmmf{jv{xlwfzz{yywzlmfv{vlgx{wmwmyjvvfikjmivhkxffvevynegevyygi{geikgwjhmmyvj{vezv{vh{{fvwjjg{evhznx{zjwjizmlki{z{jn{z{{i{ljxjznfzyigikkkwlwnzh{v{keizljkeekg{jigmf{fzy{kmwzxixkizlxw{yvhjxnnex{{v{vfjzwwzfvl{mmlxjfzzwzfhvigmnjvmhjgnyzz{inhkm{wegfmznxy{ymymfnjn{vhgizxkkhvkenn{f{wxhwjxlxfnjvjfgivzln{{hylwnxnvh{zv{hexjkmylimevhzyf{hikyljkvfmjimkeyhyhvwjkzzw{evhgxwezeiigz{ww{mhivyhi{vjkikyjhivliv{hfv{nmwfghe{wikynzziigxwlzjiigmje{gkkwynyw{eekiy{znvwex{{fzwjz{nfekhzwynjgvn{zjnyzxvjy{xfixy{giyffzzxii{vylfzzxy{{keexfn{gzgxjmeghe{gyleghvnhfzfvjm{xxjnhii{jjzvwxjwfx{vlkkzfvyxfxj{ximjzvwfvwf{eyfy{fkzlnnmjzxvwyhmljmhiki{xmlvynwfenfevfmynfvvhxwgxwngz{iv{fzkkizyw{{zxml{k{exy{jegnfhzmnhmjxzn{geveehvxhzvz{kkfvfgn{gvgehkexjzfigkivkgzznnwngmvh{{njizex{j{v{n{m{nhzzzmwjijgfz{jiex{zwm{fiwjvn{kgg{njkimw{{exygxyhnfzhvhheekvfynyjnnxyzjxfgkwwznjmhzylnj{vjimj{gjg{f{xznnfylnw{{jievzzzwikvnv{givlikkigxywnw{zjx{vnhigwyxfgzfvkmeivfwfxykiv{kkexvlylfzywxjvlwfwyfxv{{jyjvjvjjvxfnn{hm{mffgyhzzmw{ixjvjke{jgv{giifgjiyyezhznnn{xjwwvwzlzwfx{yxf{zeinyzjyjezfvgvzwylezkkzjevevhi{zvfigjgjmznvlmhggzl{yevfz{mvligwjeknyvngxwh{nkimj{lzwvf{kvjjikmvhmlmnmhjmzy{ivwzngzevjmnhnjwh{imygkgmhgvwfxfvm{jgvngzxlmlznnyzwzhjkxyzwiefgfihxhgeexj{zzjemekvjznxwxw{fmlggvnkeiififgim{mfmvymwz{v{mfieixfg{xjvyjxnxfywfg{hzfkmzj{jwlzzznzhjemffkjiwfmfjivlzwwlhixnee{{{m{j{hemigimfxnjnhwjfeemjizhnhxlmnvhywvn{jwfvnyyei{lxffeki{wwnixvwvjvhgmwlgi{hfejmvwiijizwwjhxyhegkk{hiiixjkz{wlivm{zynhjznf{fgm{nmnz{zhhvfznyiiwn{eyjhikkkmkgvjzlgihgfewfw{vwggxfnfxwkgekmfkkgvwhevjiwwevjx{{ii{kzzvnxj{hjxmyzzjxzjvnv{igvnikkm{zvlzyegigkivykexjvfjxywgvimv{kmizixnjjxnhjzhv{{v{jizynfizyyjxwfgeiejg{vnjhzezv{hefkzn{lyjekfevfjmjvgxzjwykejvfmzjjgxwhkzjmnfi{i{i{g{kggmlhmm{hkyffgjxxyfike{mmwvnnhvf{ivh{{gkjkzjmnyl{hkegzm{nly{vffezvggfzikyjjxn{kgwynhznvfekw{fzgkmwxlnwfeivggkkywvjjk{wzlfiie{wvjvw{fheyhmj{jwlmniejvjvhevh{ejkfvywznfkn{yygxizfkwj{fvlxwxyjzzn{zji{{fmgkeggvfegmnynjfizfgkxhivzwwhwjfmvh{xggwh{vvlje{ykenjkkvhylgeixev{kwj{njejxy{{memfxiznln{xl{liveifxnnzjkmynxniigihzfkmhjkyyyffzwyvjmyeezl{xig{fjiv{mhgmimikjgznwl{{fixnhvmhimwhvh{k{ywf{xezezzxjvxhhxxyfkfmzvem{gkgim{gmjiz{zjifi{z{y{g{jmhn{ezylee{vmhnjfgxyxhxwkkmyyf{x{vnjwyzfjmfexfjemyzx{ymyixezvhjxzvekyjfgjinjfiwlnlxymwnnggznwwnfmjnj{f{hgzzvzfznfzfzjmkegxevgejeivxnzz{w{jfk{iv{{vhkeenj{ijmfxwlwygkgvxljejgvyfenfjzxwmliv{lz{mlmykkgkzzgvzywwem{nnhw{hvmfvliezfwfnjnwnyjizhnwhxv{{ym{xyfimnikkkyyvhiefewnxygxhkigkkwnnjvwxfgzzf{j{kfmvwjizzie{iwnfgjgfgyhkizvjxizzhvj{nyfjgvfeeemixyhnyzhxwnwezwwekvnmjnhnjekhxfx{wivnwzyeixj{jyjzffgggnyzf{nyn{fvlig{heg{en{{y{{kkjkvwmykeegjzfzhzyyekmfz{wlkehg{ewnjmigizfgzhexyykmjzyhjxmlyyywx{zlywhviigiemixggevegvyjvnyvlfgzwx{{nhgyjxhzxzww{kmkeznzjgmnyzjjvfzzvxymnfxhzxw{gmw{eynwwmhjkxhfzikynfgzwwnvniz{knwwf{zmyzyjvzwhezn{h{jwwylzlhv{zkg{nkkemhgjkvl{jw{nyiijmvjfeeenwfxvngvigev{ijxn{zwjeiizygzzjkefx{f{wnhizekizv{zh{wnnmlgmimjmgefizyywwnhvezfkjzv{hmgkxhzwynfgzhwfmljzxjmwx{gvnnegfkmyzwkkzynfxfxwekei{mikylvnjkjezwjmnjezhxixjmwn{nhizzynx{nffvmj{gylyhjvkenfyhjghmkizvx{nhnhmjvyjvjkzfjeyligzvjz{wnl{my{hz{nfxvleihzgzyyx{xwxwvjmfywjmxhkmhkxjwn{exnem{hnlmljvjxxfvhvhnhee{h{yvhzfzwjgvlvffihg{mvn{wzj{jzzmnx{wyxlfeznxnyhfmxf{wzwhzgv{nhv{vnlke{ivfvw{enwmweveiyfvymhzyzlynxffigxzfnjexemkgekkmzwvlgeiz{z{e{fywhvxlivhemynnvhzffkkkiifxzz{mzzzy{iww{{vnzyvjwwgi{gnjjzvf{mzymfxjwjjmgg{gx{ixz{hmmh{vzlzxxnwfhk{hvl{i{likee{nwf{h{gxjhmexv{xnek{izxhx{jwym{fkwnxnnfvhemhgkkfimyvykikihvznwwkkhgeveizvgizzxnvwmjkkgzekfvhiylzhmjigww{gxyixnjkkyfxj{jyyvnkgfvjvyl{jhzikekxfvhzxy{jgjxfiiejmy{ywnngmzzjvfkz{hmkigvfzmf{ennfmznzwyfvnwy{mgkw{hgv{giznjv{w{z{xnnmwgzkgylhvnwfvikzlfxzwy{jg{my{{v{hzhvlkiizzzhm{jvyigjehmwyevn{hvkevnvlekzygkhzzvvjz{jgxy{hywikvyfgnyheyymn{weg{njiw{fm{igzzynnmnzyekfejxexzn{jvyxfnh{kyfwlz{gg{wzwwwz{{emhwjv{mnwyynzweveiexzxywfzxjxnekgiv{{egmnh{gznezjm{jfihxxn{i{vfv{wkkzjyyyhvwekmjjvwljmhvexev{{{z{gig{hmwim{wjinlnfjkwln{hxzhjzfk{kn{eviiyl{zx{hvyygenl{wkmjmynkmvw{nfiekgghikix{{m{liihzixznhgzlvjww{vnnjxexhvn{evxj{nwyyyeiy{zwfikkznfkfeke{y{{ivhmivxjezivwlhgnln{zzmjzfmwvfimjgzvjg{ykkkgezz{eizynhfiwhjxwhnyzf{zzhhmgikkevjggvyjhxxhzzivw{fmvnvjjzxyxjxyvwyjkihmkmeegigx{k{vyyevjvexkmixvhnlv{jgfzyjkmyyfx{izxmhv{nn{ljzvf{jfggkkm{f{zy{myjzwwmwywxjywynwniejk{ifvyh{nhz{wim{eexzjiehvwhwfvnxf{jmnnfiefznnyhvlgzjxgkek{mylzwwnkkhzgmxfkm{gkgzn{lwweizwfxm{{kwlxhxwmljijeee{ifvekz{jvjmzny{kixjzlzxjixf{yizivvjfmjk{wjex{xy{hwyeim{vhhg{gzjhxikei{fexznikfky{fxhkegiihegevfvh{nyfvnfgny{nevfigejmww{khkgvgmgz{eiiyj{gxnee{xzzvwzny{jkkm{eekgxz{zxwhwwjiny{iix{xjmmwx{jgvhyfjx{nizvwiimjkkvnevjmevikje{iyljkjkwhn{vfvl{jnfexizzw{zwnikx{{jzf{e{{xfjzxf{hjzfmvyn{njmy{knw{iw{fmzlfvhvgxjzwykezngvimhgfin{imzvxywywnixjvjghxwyvy{imjzffvmwkivhn{jxzxzx{fexei{vgi{kwynyezggv{fmzzixvf{ix{{hzykk{fmyxjhvjzkgzynfm{gmmhixzzzzjg{lim{kkmynnfmfex{mizeennixxfjzwy{wnlfgnh{fxygvfgyjiihzvlv{mnhkjkeivhjknn{hnh{{gx{fexyfex{xezgkwnn{gzynkejkezzfjkmh{ngeizhihznlyygemlge{fhgmln{hmixemimkmxfjkjehx{nzwvwev{{{iy{w{{jimvwnl{{{n{gxwx{yyzygznymjz{xhggz{vyvfm{vlxl{fjkkkwwxhxfzyhvgxfennjxzl{j{jfx{zznm{w{mjzlwn{lemvlxjw{y{zvz{jizh{zzfgvfmv{fifgn{jvyw{vhzzwhzgghikeimmh{{yy{kkmgmyfimighmgekezzhmzf{yw{hgmlxhgggzjxeg{{x{jzzjvnjxyjzf{e{mzhzyjg{kyykmjxivnf{jnjzvzjy{{zfvnfzwjzm{{v{hkeznhe{z{lvw{{ix{mzyyjgznyfz{wz{zlii{fzhwynynlkmv{zlhxzlyjnnwyhmhiegzhfxnfiefkiiikvn{lizfvjmzyjkizznnlvfjzzwjeegfkjm{xixfkzlggznkegm{gigfznjxh{{ggzvyjivee{n{jzyjgml{njmegikjgmyvwgkzlkkhxzwkk{{ei{xzyzxjgjzwwwwjezvzziekizjnhwwmnzl{xgekinf{jnhgmylmy{ifzkkzfgxmjmhw{{wfe{gkg{m{lkgekjgkmfgxyvlmyhvzfhiwfeveiwn{wjijeiefzyy{w{xxffmizy{imigeziemwievleehvhkim{hv{nynhigxnikkkywjmzljzmhimkixn{xkkhx{i{wylxjhg{fm{{xvj{fzy{zhxwjkekkmnny{k{nnjekhijz{i{fzjwnnwwyjiwf{iyhjzgvx{yn{nfehihvimn{em{wxnex{xvyxngizym{jm{jznwlhixnezfmwfvnjggzyyzy{mvfmnylezzw{{exhzm{vynl{my{zwmhwhylwfnykmfvwnixzl{n{xhezlwnnnvhivnfkizhwlnf{jjijkvhzvfkgzywvlxw{{fmvlxnmhwwwnz{zhwnimwlgzxhxlhzhefiimfijvmhm{mjgz{z{fwjfehizy{yje{zjmwwx{ig{jzvzvfe{e{{gxhkjzyw{njv{fkeywxlzjyn{jv{{w{hwjeihekejimwvyhgzyzlzwzhznevw{yymn{fxfixji{nnyeznwhvekv{fgkkfehmv{exkgznexzy{ixww{im{{vwwhhivfxhkkynekmj{nn{ee{yxwgmjxyliivlhifkxlzwzhhzxhki{ngxkgjmjejeyjwhiiwnhkkmnj{zvwwyvlnfkmfevywjmhvhkkex{xmhzz{wwhvywjgkgxjijkvwnjwlfzkkjzeghvmhjeki{fgzzykmvfxlkegxhzmwxhgmjg{megnhkg{innivkmzhmjvywhhi{jxwxhizzwevgzevfmhmeifkke{xixfezwyw{mwyivigfxmnieynhkkghkgxekwwwhxjwlmwfx{vhvxjfk{mfxznvlizhmyjgiixzlnw{{gimhjvyhimwlji{{yywyhiyl{{zwwlfv{eeenjjzhgimfzegfgyfmnznwlfe{yzzyjemeeigvwzfmlnwxfn{yywf{vyjyyx{ikzh{vmhhgw{vjhg{jiemyyyww{ynwkkiewjmwmfzn{fji{zhxhi{mnlmw{jkk{kfvigfkei{{fghxzhvnvyeiny{eeeyhnhevkev{fkigynvlegeifzzvwyhifiwfjvkkwfw{ww{vm{ixfzvlggwfzhfefkvnjvjx{k{jjv{jgkxyw{imiizxivmfevzxjz{lzjfzjgxlnyxfjizxzwwhgmnwmwivev{jmnnfvfgvyf{{kkizmfiigmjkhmhxeewjfkzhfvmfikiivl{ymlexzzjiyhjmwjginjy{{neikkgmjknjvyeijigmvwjmem{xfgjkexwjexvwzxvfnnx{wljkfizwxyfgii{wmhyhmfigmnynimeey{{k{zjxizjewwgevw{jmlxwnwhiemyyn{iiz{w{{lvn{jhvfkxhhxzlfizzzhznvlwnhkyhzzzyiemw{fxy{jmhfghgylfznfxfzhzvny{{eghi{zekmnz{{zjxhiyjjgigfzgvvngvywzhkezniev{mfjknl{evnkife{xzynw{j{vwnjxwnzyhgeznhjkfxw{eiiizyvnzvzwwlvfny{h{w{hfzhz{fxwkiznynkmgkmjz{{ffmzfgmfejkikheywvngkeinfwfgxhgfvm{yfggz{hzgmimjvhkvfkigzvjgghkmnekz{fejenwexxfx{zyzjvjwnylkgnjgigmxfzf{wggzvki{h{wzvvlixzjkgvw{wigyy{kikmyjzixfkyw{jiev{njwyzymhfezzxwyjemvw{yhmv{gg{lxhzyei{z{lmlhihxgikmkkhgjz{leefgfxzhzhkkje{kxf{{{vyjge{lkixwzzzhnhznjkznjmmyyfxhfi{myfvhzyhemjmyv{{hkkmnzjx{jzhmek{ezvhvgiivjkzzjgvwixjvmhhmgzxnxwxyyygkeiyhzynhiiylfvemkmhvnhwlnwfefx{hgvxhzzml{zzwfizl{hw{xyevz{eejiz{zy{x{wgeeezjixmnyhezxyhknjek{n{{jg{yigyynfiexj{wwngefmivie{izh{fmwwhmfwwgkywfgv{ynjmnynfwwwlmnn{wlggyjnhnjylxwgziexy{wgv{hxjjgmnhxwwnyggnleg{yvnyjkm{mjzjkvfvy{vhz{vnyjkfvzjnnxnhv{fny{zhmjkzf{jegimigfvhgnwemkmikyy{vfzvhzfyjigmwwwzy{yge{ezvjinjxjfv{wjmix{hjmywznvfhkzyx{eivynhnlmwfi{wxwxyhxixnh{jjgeejzmhvwzvhkmnyjigwj{wznwjimznzh{n{k{wigwhhewhyj{hzlfgfgxykmmh{ez{wymlxynnnnzvjggvnyjmvjfmxygx{nwwgmexhveexhzlfxkeexzyfgzym{zlem{jjxhvfkzzyfz{wyxlnhyjzwkm{jnjjizlfm{hylfzgexlxhhejvzvmyegwjnnhgkkjkmfznjiyjgvizfxkkwjivhmmffgjivjjmyfv{v{zhyjikx{jinffejz{lwwhkhz{l{vgkkmjkhzkg{mxwkkvyynkkkmz{kmn{{iwfyhz{fi{vwyiewh{xgvgi{w{knlgmfix{zwjeiezvz{gg{ziixyvwikfgjxxyjgwwizwlxfiknf{lyfylhgizjknnfmzwmfwhmjyfhzjizx{fjg{w{jw{jvmfzzywz{{xmf{hmfkk{{gmzhjznh{fxffxxlmnkkn{xf{evyeevwyfizhmwfxh{wzzfg{{xl{kxngz{lywzvznjknwznxnxjzznwhxvjvy{xwnjz{wwfmnvnxhzfzfkkwjxjwwhvmyfxzwwj{nvnml{nvyjzfmywvygz{hmjivw{{xmwzjixje{wiemyyfzzwf{gfzfgw{jgmf{gm{mfzl{kjkev{yjixjvwekxlkmwwzwnjzjjzizfzjknjhehxvlxfy{kmkmkgfkivgexyvnhzixnfvjjkwy{e{h{hkivh{yzhzxiiw{xyeijzfkjk{ihxkeemvyfkwyzxfviehzwnfevw{hiejx{e{jem{wevkmkehknhxjjivwwfhxz{mn{{hg{jfmzhzzznjmyfkegvyj{yjvnwz{zlnnemem{wkemyw{nhx{{jjg{v{yhejkjeee{jxjzxnyzv{mzfiiek{ynjhmexznfzmhzhzlikmhevhmmwimzx{zzjmfnh{lemmnxhyfy{ev{xevy{hi{knjvhjegvhgmhzvnfm{ivizexie{lz{hxnhxhmjwl{{mlheyhfvhggigxznn{hzyhnfgzvhjkji{{izekz{zlgivyzyzn{l{znl{fevyfwnnfzfiznyznjvkmnh{{zljeyfnfz{yl{nivm{zxyhhmxjkkwwxhhv{vwwgxekekmfmjywxnegvwvln{vhxwwljvjm{{fkmjwl{xjeznegegeeiihvevkgjvm{zwjeimmwyyevyl{wikgknj{inhggnwixfximm{wnezvhwynnnhem{vemexjmylkmyw{viiekfkvfxhjgywjmkkn{hvfvwyxhzwhvxhhgfvvw{xfmnjhxxnzyfimwynznzxzywhhkhiixjg{ezfeifkmhyfexxjekwffehzxj{eeeexn{hvyy{{{mxhzfznzzzlzywwxjnj{zevfx{ffzekeifi{lfegmgmvnwnwwzy{zjg{{xnwymfginhzzke{i{zjmhzzfeewhnhwwzwzwggwynfixzfw{{gv{zjwhzjimex{xjvnh{xywfg{y{fvnz{kmheemivjgiivfvwvlje{vegyw{jgzixxyjz{{geiefmzvxy{nhzgvhe{yizxyxnzjyywjfgwnzxyy{{{kylww{zjeezy{ezz{gkfivj{{jxjzeiizzffgvjmyyym{{vhg{yjivwn{hkzyhgevfgvjevmjekmy{mfewynw{mn{ikx{hgzjgxjkjkkeywevwngvyhnhfvhmhvhm{w{v{k{e{e{gznxnynhivyxnzngehgzfmfgzyfjeem{l{w{gvj{yzw{yggzxyjhg{khg{{nwy{wyvymhzvigzzznv{xyzjhvy{jehiizw{wnhx{ivnekvfzxyngkzjvjkgzffxjviennz{{emjwnkgnligmyekvjxjzyigezynzjfegxxfgv{kxlyj{l{jnf{vjvnf{jzfm{ekwyyyixvynwwlyhvfjgkgzjivjg{emhfvfxjvjg{v{xjx{{yfnjhzxwkgylgkvfvj{giiizmnjxw{fvhzwyxjzjgeeizlvfxl{nz{jxjefmjzix{lievyjifzmhnywnzvxjvfzhvwwln{fivy{zxfz{x{nyz{ei{him{f{xwjhizxivkmvffmmlgxmjjgnwxwjigxjvy{z{{ngkkmn{{{km{yyhnngi{eiefxgkeivymhjvzz{izzmlyhwfkmii{zik{hmleezwkgiewnxwgvwlimvhvfyfmjkigzmlwywynfnfjefinyv{xjv{kmjimfhvhxezvfmwhimnylhzwjivgejihxfekkzxfvzfzwkikmkemj{yjmfigv{x{yhimnyhheixxyznmwvfgvjmzfgxkiizzh{lvn{yxl{enynfznv{ji{yvnzzgxxjvwvlywnfjewyevgijvji{hfgigzjzyizein{iihkwyekwwzngvjgzjjzhm{efkzwxhgg{vzlmwfkfemheg{zixzznweg{wzxhziexhvn{yvfhvwfnyeifigexngmzj{ghkixhky{egeximhkxngkign{hmnjzx{m{xeeezkixjkmwhegn{mlzzggyyhxmljvjgxwhegehxznkivyxfjx{f{hxlvjxh{weeigv{ieigvyhmhmke{gx{gxizjiw{kmvfjeevzw{wizvhxym{hknyzz{hnhzxzw{nxyxjfvfvmlfkzwywxjnwvhzjjkgivy{zw{myzw{y{i{{xhhmkgjiezxh{fhvvn{{hvz{fmkgfizxkgxlzhxwfegxjgmwxh{{giyf{kxjgifmiveikmy{x{izeg{m{lkezlyh{y{ywwyngmxwfenwkmxwje{hjmgifzhekizhxjzn{eylkkvwywwnekeknjzh{jjkezvwfenh{jywzhvwixmlegnnmwzwmf{fkmzfixhgeefkfxvn{fiijvnynlz{zjyfexmjkgmfxl{{zfnlivfi{vznkifzjegmxhekji{iemjxz{zyivfezwikekigivwj{jxnvynfmnnffe{y{jmynyjezw{lzwnnvhjxxlegnhfxyfxf{zmnemfgy{mwkijzkkkgix{hzxfzfmyyfinfwf{enfjemn{yxnmhjmzvvynhjvhv{zevzwgijehk{jfmjgzn{vhinwki{mvhjgzhylkggiggfkjg{kxwfm{{genwkimjnhixx{znjevlfe{{{nekgxzjy{nyyynnv{zhww{zjenjii{geggxm{ylyjyhzvgg{hvlkk{gfigkxnvlvjyfhvjkvjwnki{fkmmlww{wjgw{vyvjzfvjjvxlyw{ww{jvxy{fgenywfmf{{zn{vhxmhyyizjxkk{wzlezz{mlzvwl{{hxivgxzlxhwyfmzvznfieeixzwzh{kjeixxyxyighmz{v{egz{zwjvvhikjmikei{neevnnyeziigewfxyivnyxjnhfvikxjxwmygzhemnnfmjfzxhv{kexnjvhznlvjnfyfjkemzvhiivxygkhzmwxlfvgizlwhnlhehzzvy{yhgmgkhvzwwneeeggiezev{xvfgzjkxnei{ykgjmhi{znynngg{yvl{w{wjxkmexjxfxvlz{wjjxjezzwwmhfmn{exmjylmj{xjeieekhevyigxlzjimz{ggvljgzlmnigvywliegezvyjhvzhwy{hkkgk{jjvv{jivh{wjxjkv{evgvyn{fkkyhiiwjyhjennexvhiimnylhmyhkifkkihgx{ixgg{gkmnwmlnjggzfgg{mmh{lgvhghxmhfvwhfmxygvikjxjzwyzhixjxfvgx{zylwjwjexwljmeeiijewywlnyyhnjxhgxkeex{mjgjgnjvnfe{xzhzw{y{k{jv{{zhmfekkyhyneejeyhw{whxhemyjylm{m{vwzyiviv{vznzynfylhkzv{{zlixnnjzhkkijkfeikhk{f{fhgmlvnvh{xgvzzwfnjixkiyhz{ixnhwhnlwyfk{fjinyfievfewhixgm{hy{whwl{fkmjgz{{nmjvjzweiwhiknh{nggznxn{efe{mexn{gihzxfyfjeixeegiezjikiy{yl{gm{hg{ekmfiznxlkkhmvnmjivw{nnji{vn{fejewwjmxwjkixgvylimvjjgwymfkkiznywwxjwfmjjxjkhiekwnemwlwywnzxgigv{gimzyfv{f{w{eighvgz{zyfvw{x{hgm{gvj{gvffxkejg{eigkejiemnlwl{mhm{{{f{xkgy{hgzhhv{gyywnhew{v{jgxfvlyjywvjhexyhzjxnwhenhyhxjjvzxmynl{lvnhe{gznfkxwhmzy{zhxezm{emjvmnjg{yzlyfwwii{wxlyjyjiiivnjwfmy{fxjyjgehzwneiwnxhnjigimfmnyfxnwjkfznnxyv{x{yjgmvj{k{ffkwffmznzwfzgkfvzw{j{lfvkgyf{wmj{{{nzwznmfz{zzfzzvimvhzfkkgizxnn{{wf{njzwfkgnymnkk{h{jv{gxwwwf{evngmgivyy{evn{wnhefkjeevgijmmhxhwlzwnwhxvhm{wnexy{{fgv{jhvvhkiev{jjxhehkgzzvzfzhizigyl{ghm{hjgvfeegvjv{wywgmwjivmfkmxnnfkkn{fkfvmjznxy{lzvikfgjgfvz{{ikizhzn{hegnfywmfhxjiwnhvvfzlyngkge{zywiezw{yfin{gvmjw{z{hzjxvyz{ekwffmjv{fznyh{ezxz{zznwjx{wn{vwhvmhixzhxhgm{eizemggyygiml{xyfegxfzvhvjzzxiijgfehvgzhzfeyh{vhkzzfvhvvj{{jivfeghigvz{wnyn{ikkvjexvlgkgejgmhzwwlgegimlfinlfvywixxjhvxwvwxfw{ixgezywn{yy{ekzl{vjkzwzlgx{jnjfkx{fkemzyfkhev{{{jkw{{wfgwy{hyykewlfkiifznjxyynyyzwmlvlxf{fnfezivmy{gzfgihz{f{kxyhegz{hzzzn{egmgvnwwfxh{kvfjejizzfkxfiizffgvf{vvhxjyjy{kmjmfzjgfkywigylyjwjfiyhz{{mgzfkivvhxljghzzngmwhzwnhvjwnyy{xkkx{kiwygikifkz{yn{jezkijghvvhimhgjvznzyzynfyhyyz{wnnfyfvhzxy{mwzyn{{gezxnkmixvyxj{hznvh{fgv{h{xgvhmmnhzxfmjjg{v{ky{hvimyfizzhfexyx{jejewfvwwfhxyjvheefzkgjmki{hmf{y{zvfzzfxkmm{wwmnz{eekixh{jnyezzx{yikvnjvxhzjkk{nzhy{wj{fexnlggmjx{ex{mxwvwx{kgjgiifzhxyjnhylnfgmheyjkiwfwnke{jxfnnzfyygvyyixem{hnnki{gvy{jhxheznmfvwxy{mx{zxmhfvnwznx{igjvjimyzlvfzneijmxlx{jkzn{m{zgkvnxngmfgivwfhmzynjhzkmvn{ivjzyzzyfwywwzfylw{xnyj{{ikwfjxzxw{{y{hzxwnhxznfggezvhxzz{lmwmnhvienlyyeeekmw{imlz{ke{{keznzwzyekvh{mnjmhzziegvzvhzw{znjzjezyfzw{{{mnwy{kmw{kxhzhxlimekmjfzylfe{ygknyyywwxlvhz{gvwfylemgmekfifv{ywjyhvjkmmlwfjifvzfwfvwzh{ymjvjgvvw{yzlxhw{vwiz{xezkmyly{jihvkizyezjgjxkevlimyyfinwxwfvxn{wjejifmwjylvfmnvlvfjzml{jyjwy{hvfxwyjfzggnwnygmm{myyyvwjexlivmnjemygevnwf{xxynyfz{jwyiznw{z{g{gw{fzz{nwnjgghev{{zhzz{ekvlnfjivf{wjmvyjx{mhxxlhxylfvvywhig{ljiivfkkmny{xy{kmynimmlieegfeiinhmly{ezzlgm{eivmj{ekejiixjgxnmjny{vfike{gvyx{fghmiejvmfnyexmhhz{{kexwkkfiny{y{{jm{{kmylyhzlv{fkyf{iywheyjynmfznmjyhnnggiihkjkxnhv{whzeghmgigvyymnvjeiixjkeiezjgjvvjgkjihxnnjzfizzfzkgfi{emykkx{mhzjvwex{ewl{xiv{yyjxlixnhfkvnvf{keznjhmfefxnyznxhzfhvzhwfhe{{emyln{mj{nxlzjvnkiwj{mwyyhjghv{nmhfeylzynnvnmhwwmyyfjzxlwfjkfxhv{wmhwhjmzwjimfhzwh{mjkvf{evlnwhxmyekkmkemf{lxyw{{zfzevwheigzfkvlxyhkjkxywwivemynjgjv{ikg{eyhjxhimlvhzxiin{kiz{hiwnzvwwje{{{ifmnyeex{wjjmmwx{{ezxgzevmynnwjhi{{nwn{w{{mylfm{njg{nim{vmfw{ylwfkmji{nhm{wxfzjgveznjighkjxxwigimekzlexnlyfkmfm{vjevyhzxhjihmnfjvgveifefmwfixfx{nkmgkwlkkfkvymy{jnhnnjihv{mywwyzfiehxy{ylkkzlez{vjzexvyzyyfiemj{vjmfzkgzj{ljgm{ynwyn{kgwwml{hjgznkiivgkevgzzvnjwhigzlnlyyxjezxjmfgmzf{gvlnyyj{fvf{k{{zlxlgikefkgvzfemfvw{vfv{evie{ljzzl{hzjkezhgi{imf{nkgee{l{{nj{kgmzx{lvjemmyhmegyjvlfijifm{ijkjgivexie{vxhie{ynyjkjvhezzixmwy{gmwnzjjmwjnfhmjxzzmwzhgi{k{nekz{hkwywjeejmxfv{imzxvwhm{evfynzf{gylem{zkkn{evizvnkifxgefvjznyfgyjii{y{vexgz{mz{{ynhxhjijehmz{wlemhvex{nezvyvy{gzxgvvwvfwjvfezezzywjyfwlvw{ejgki{ex{mjznkewfxlvyxhev{zfm{vvlemxhxjywx{{ey{mljkfejmzw{eimzjwliifk{{xhyynjjxgivwjmhkzyzlgegzkeezvhynfkxwegyjexzjvhwnn{vywwwj{yhkfxyhvh{hjzmwfxhvhennvfmyexvlmfnhzxixzzeenyzheefvnnxhjkjk{khxixyyjmgggkwj{fjg{xnfjeny{{eizxjgmwzyvnyjevjkvh{iyfznvwzl{hyf{fyfjxgkekwnfkv{wj{xwjzfhghzz{ixm{{meghxnhfkvnkgjxm{fmmwyyfk{e{v{vhmjvkknfhgkigijixlnykgim{yy{fe{{hgwn{fgxnykevy{xxyhzegyn{iwww{mlzhizvjgeigez{hvykinfgmxn{keeggjezngxznvjkijmiewhkmmnzyhixf{wywnhgvvnmyylegkmkijzv{{njgginfmhm{jmzhnwmynnji{jfxfvienlmyjzkm{eji{wjmgmivevez{heizlzfwffeegegzjjiwhkkieigzyjehxxhml{e{hzziinwwh{i{y{yzyzlzlkejieziizjfzx{feevvnmfhvzj{hxhwlfz{hhg{jxn{efiwnjivyjefmekjz{{{yhxfihzznhmy{wwnhvfynnjhijzeijkjmyl{vje{vvww{mlhvfe{ygzhz{hyw{mkkigxl{jvfylnhnlfxyfzw{zwjikzx{kgvizeeiznh{gjmhxixzzxnyhxhvl{{gevf{yfzxyjgynxfnwjvyjyjwnxn{fxfeixnwh{ez{zjywjvvfixfefifigxgzhefznhjm{ifevhjm{{ixkmv{jxkgfxizfemnjmxlzlxwjm{mevnh{j{fzlzwzwjeixnnee{mkiwfwlmywfyjivwliznjzwzvgxvniiev{hznjkxwjkjkjevjvl{jimzl{inlyhjxxj{yvhjemfzj{eyjjgyyzngvgm{mkizzkezxfehezxkgkivnwwyywnxnjxkejkgk{g{fz{{vjxgimw{liiyjylkmfvyynwhg{xwnkgyyfkiezlezyfxjjxfxfk{hynmyyfmwhgzwfgm{feje{v{v{gnjzjzlgmnnexiv{{zz{gznznx{nh{exfmffzxnznem{yigekfkxfnlnj{mzhznnfmym{wnmlgm{gnfegwyjezyjzylhzmngzxhynyyhvfmigzznymwjzjgigjezyiggg{vvn{jzljvm{vjmhnhjixfezgzexyjm{vyfxgkzyx{{igkvlhkv{mfmyegivzzwyevfxhkzyvykifgizxjjexjvnjmznvjvjxwzzznvlegwl{{izgvyjfxvnvfwyxfvjfgkgigezivezv{jgywyhjkkggvmhfixljgemzyzjik{hkmfvmjixzljzjviz{xmhgkvyn{{vgzzvnhfvnnwnfkeizh{ghkgkfg{{n{vjvljxyj{ikm{mjgezeehi{ykgyh{wjvzly{izggvy{y{xm{hmx{ylxnixxjwwwhnjiekehvezgegzjeyynyxykkjkikmfxwvfem{ynlizzvee{iwjx{{zz{hgnlmnzjy{nfkeyl{jvwnfevemnlimzwfzgizvnjwweghmyyhgjvnlnhjinhnwzwjiwhfmzhjeyffgy{zf{l{k{yv{mjeiwwvy{w{wgmizggjkgmix{y{evlnhnnkgkgfgm{v{zzwn{lgkmjnhgxez{mzfzjjiekmfzzvwznwl{v{y{v{yjv{i{zwy{eigzyjehm{yheegx{nnix{jn{mhizgkyjnlgxixhxfegzgievgxm{mjgxvfexkkynizjxjvv{vnikheimzlwffz{jienjkgjkzzwh{efgyyynhevl{igeiveegxmhizivfxyjvyeewyywxjhkkiemfkvhegjgwnyhemx{{gegixkmmlfkvhnnzhynmwylzf{zvngxjinnwhvjmfzvjvyn{yzzxy{wjigefijk{xzzzwmw{zwjnfzv{kemylnj{exy{ieghzfmzh{myyhgjgwn{wvhezynmjnhynfxekxfhi{n{xekzn{wvlwyhzxhgevwiz{hjmv{vwxjmlv{nlz{jekiivjvm{izzngi{f{wwl{{xj{v{eekww{ehxmyyyzxke{kz{kmfmxfjkxhnnnygigknlvhmjzfxnfvfg{zwwxfimjk{iznzykkzfnnvygghgik{jhxki{hggyjy{vhxjhxxlje{lfxvjfizwik{iyhjvgvwwzlwjjvez{vwnjxjmwymhjgfizfzxz{nf{jzfyn{zxhivhevnmfvhgmyhkmgejgvyeege{z{{ekimyfeezhml{gkgyfek{jxlhihix{iifmvnhzznfgemfemjhkggfmfeeihzfm{zjgzhw{{xjmfmzvjimwgg{izwmwvlegixfx{fzlnj{kee{ijxhi{{evmfgmyfv{ixyjfmzhkkhvhmxn{nemgzwlnhez{xjmnlixwfimee{ejeezxyvhw{{lgi{fhg{zvwvw{kimmfggzlxn{mwh{{znv{zlgkzx{yxlwlnlmlegvwmwwynwkkmjjejkxh{{zlivzjyy{x{zei{zmhgzeinhzliv{xxlxhexixzyhxkknhmfexzlhkiiwyxyzn{jwh{xikjey{zlyl{{{lgkzxfijin{gkmlgxhimfm{xwjix{ikgkjkzwnynnmnfvhggmeefggkzfzfeex{z{hv{geifk{xxngmexzhezx{{{heiijvkm{gkifiyf{lfvvj{fwlnjimzn{gmlix{ezxegiximvwvlmffmwnwhx{hvwwjeny{{ezgz{nx{{kxwfgfimn{vxjvjnn{ijiyjmlzh{fekwhzzn{{{jzkmwhxl{mkiwf{nyyvfwjjxxhjxxlnhfv{ihvx{emvhhejxzfzvjmvnmj{yn{gkvlkgfimnmhyhvhfxfeixwfimjifzzfn{hijzjxfmjxwnmjjxeeezy{fkxhixmj{yekfijizyfzighxzfmywf{gwhvwkexwxjjzkezxfm{jimwnmwhg{fgmjx{zvjfgjvienwigixvwgeezhzwjvynyywgehkzjxjjmixn{m{zjggx{gkvwvnjiwhhmgejiexkky{eenjiv{ezlggeinhig{nxffijvixy{vjzveikkzhyfkenjwnywhzjiwyylezfxee{lywznexfzyyzwimhxnwy{ivhennzhyjylvlxy{him{yikjevjzhmhzwgiem{hnnmjmn{iw{znvlgxvjhgx{myhzemz{m{ikgkigmnhiw{hxwh{x{wimznvnynzv{vggyhyw{yzxzjnnimyyivmhznhkzyvhexhkvjjmexzxexggxnm{ezhgegjkfzzfiizyjkmljiwlv{v{{jgeekfixwnhhk{hhvfejxkeigkkzxjg{l{yvnigny{kmygi{zfevlvhzwmffmfm{jkizxwnyyig{{fkjkgmhkkkw{{jmfegywhxiem{nhm{vnivhzeigemfwjvyfmmlyyexeiix{ikkkeezxhwl{mmlv{ei{lnjny{m{iggvhgkegizwleiwnfmwnzhmyxliez{vwfzvnevig{jvy{{jvkkxwfijzhmjxkmfxvjhgiemhmyxjgm{{zwmf{{iix{nlgixfjmwyylekxwevmfkemnigm{{jw{eiyhwnzzxnnhgvx{xlimmlmnzwjiy{emwfyn{fkkexmlyfylznnwjkevhxkiyjyfjmyfyneg{leeywyyzn{vnn{fjkyhgmke{vjzeijgfvzwvhvwvjynfz{gzj{iyfz{yjvh{fvhfvvlez{jjzzwyfwlmnwlynvwn{fxvfvjxniiezzlzhgejehkyh{nw{egnlmjhzmlfxvjgxnhxhgmwnivfkwfvjkgmyeifmwlynjzzlfmiinnnnmyjiizgznj{{hmwhiejgmniijkzlw{gzzjfkjiyfxhikkgggzhmhfmmhwwyweizjixge{xxy{f{zfkvyfxeigemjylz{kkizggnjgkyhxl{gzfvnzlfxywmwvlx{mwkeimmfmwy{nlwj{y{kzzxjnlmwjeekvyjkhiekvnjemnm{fizj{zyffky{{jnlnfyln{hijzikigz{njimge{hz{w{nh{hxnv{hiynnnixn{fkggznw{{vjvgxek{hhvgkemeinwzyhgnjggwwxhixfgnwyffzzxii{vylhkxngmfim{kemffgjiex{fhe{g{jwn{{fmegkkhiwh{emnxhez{kylvnkkimkifvzjxfix{kzxyy{{z{femn{jeg{ywjz{ikkggzzygviv{{geiv{hkmmjfgfgik{yizjkxym{hvivzhivhxwwkmekkkhejiggek{{heywjkgemy{hylje{kwy{ievfgmjjijm{xwjeizjzz{wv{{gyhgeezfigvgznyimgegihvzzzljmmjzhhxxfekzwyjxymnwfyjwy{whihkik{zmjjvnnjk{hvy{zvn{yxhjxxhhxhvvnjexjhzvykiemyhwwnnmyjxjijknhhvyh{ynfjghmxwkmjx{v{ijxjkjeje{yz{xhwn{zwhiiivfeek{j{vjvemzzxwnlimyhfxnnzhfvvlgxzlizfmxjekvlzlgihiegvnevvnjikkn{gz{yfgwnywznxwexjxnhwyjemhm{ik{hzxhi{gjv{vmyn{vhvniifkgky{zhegjgmw{xzyjiegnyvwzheemjhevnjxzvjgfvylginwmjzfkihiexv{gkfv{xfe{wfkex{zeixhjxvlhezfzzemvwmjwlzvzzvwz{ekyw{nvjfvwneizzimmwynn{jeegggemznhinygmx{{giviiyh{mfgwwvfje{z{hhmkkxnfgyyizzj{emjywzhm{gmimemmhhkei{jvyixjeywhkiewywnxyxhzyekgkzzzhhiivvwhghgez{km{fz{n{enfhxwfnnxyfz{jzxfgzxjvjxzljvnlvjhmxljg{vmjjgzjwyzhfzyfxj{vemhghihzzzyyzvvfjgxnigvhvjvfhvhknwzf{yvnww{vyl{zzyfzvnzxhvfzvfkmvwnljgwwxjmj{mgejmwykivymlww{jwfmj{yhejggeezy{zj{vnnywgkfmzjnlvhzxmhzyvwyfvnhkvhvnemjxjmyynwnlei{xwyeiz{iiyweznhhzzxwwzlnnfejz{hggemiimh{vzvjewf{w{kmlyfhexy{hezvhjzjimh{efmylezwfgmzl{zxyz{{ewnjg{iyjvlylzzjzwn{ffzz{zjn{xfxhgvmyzxvhei{vgmv{ezkgvfyljxhkgz{lzxeiizgkzliefzvjznfmznzvvljgnwjkvwiixl{jmy{x{vjz{lyw{gzzhkhex{jmjgnwixnfnfv{jxjgkeizx{iz{xixmhzhv{kkwlhzfkjmywkg{fzyeeiixyzfnnywv{w{hmn{{fnnxwgvmhggkejvmweiikmnnhfefeggjevhixkgkefvixz{jmgifeyfwnm{zy{gvnmfy{ekeexnvfgkjeizxfnhzjyhm{zwnffzgmnjkeemnfnfnh{kkmwwixkeezjzfimlevevwfvnkefmzlynfxeggzwniznjwwxh{yfkfe{w{jfkmwyhwykggevnkmzxiizlvhzvekfegvekzyik{e{xzjixzjhggvhxjv{{mwnwkmiejmezwwjkvjizkgwyxf{{ynynwygmmnjxjgx{ekxfhxjkyhnjgzikevkgwyhxzjnyek{e{hjmfxnnwjvj{yxy{zww{zeggiki{j{{jgyhfx{zhgmfmywngxyh{givmhjkjxkkigjiekjkmnnwikjiixfg{nn{xjxwgvekieevzzyy{mvlnw{{vjw{iivyjgy{jvmwv{vffxiewjmhhevffkji{yxjii{lmywwzfjzfz{jmwzv{hmwjiynvw{gfggzikigvhhkfizhivyygeegxhkifx{knnnlfxmlgxvwz{nhggxnggfxnyjgfgylgkmjevgghvxwfewjxjynnjwyivfeevjexygi{gzzvyyy{f{v{n{wjzjkfxfmxy{xfvy{vf{{zwgiegzlzvy{ivixgmezivxyz{wnnjkifkzyvl{xhvzjzvw{gg{ewfvfnj{mjmvwvnfiieee{{hxjzzy{v{zm{zzgmwffmy{zlzyemywgefmyjznjigzfvggzhjzzyjizn{nyf{wyjkmfmnnz{n{zyxfjifvmfzzjzivyh{gmwylxyzv{f{y{x{leevfkgkmnyfgwhzxzh{y{k{fik{v{lmjemyjzhzhikw{evn{wwvhkk{hwhwynhynhinhz{gkgkznki{lzzezfxyljvhmwyzh{h{g{kegjznyjm{hfzvw{gimv{{ifigeginnheemmwjknwwlfz{enyjx{fhvvn{{zngvmn{yggimjximvwnhjziegmevyyfmwfexyhiiggkkfmwj{hwwyhezkkigfmxjivyhm{jigemnywemjijzvnwnw{ylkmmhzyvjjxjzn{fihzyfwfwwfvn{gmek{levexfgvh{xzzfe{{kkjgwjfihxjx{lzf{lwhjxeiyfhmzvevxnmlxlwwfv{kxj{nvjkeimwwheylgkeeylfievmjxyegimhvnlzwxj{lmhgm{g{jzzhxxlv{m{nyjkeeekxn{zzwiixjizkievgxxfw{hv{nmhyw{ieije{e{mzvzzhvxhevv{ev{hhxexxlvhz{evjzznnyfgim{xfzz{{wvnfefgkgzhvn{hmjxj{ijvfkzxwn{zgiynfmylvyvhkmhmimmwvwizwwiviiegwl{mivfxixyjjzvliz{jfm{jkkjgnwfv{wfefekmeijvgkezzliikmkife{ehvjev{jenhfehzfxxyzyzwik{{ynv{nw{nfkwwgvgziizhv{{egiig{gjxnykem{fiivikynmngzvhznixzhhkvnjkfmiz{jmhegwlimhk{{gg{kznvjn{hzw{zhevvyzv{xixxwyywfzjeivnfknlxlzwgxhzjeezemyfvnhzjxzhgm{mnhiejmjim{{mjkgenyx{nl{x{ehvhvfgzvn{ixmn{lhejzxlyyemm{zz{hkg{yzxylhz{gyyjvjxfgxweghggkvhmhvlezzzn{jxxfwhwjjm{fznexnymjyynhzxxfmf{ngm{lkmggn{w{kmx{mjgghezznhkikgigiemwikmfnlxh{wwfyyfkfzzh{vigzngizlwhmlzh{ywhnnxn{f{h{yfeyhjmgmhew{{nzjgm{lmhfgfkixfvwlnw{mjefxywfmgikkwhhkyymhzxwhxjiinjfxwnfxgxfmzvvjggizvlmfimggn{ggnnnhzvnnvwxyeevwgefvyngkmlhgzwzhzjmlzlmjyfkigx{lfmjejmgzyhgg{fekgmgm{zeexhekzn{e{nzzjkxnevwlx{fiz{z{ikvfznmnxhvjgixl{kiejmylvwvwiejvnyhiikjmzjx{iijxim{jvhyw{{yyexhkw{nn{h{ggvhzy{fiiege{mjvje{wwl{ihmemfxnyekevyfnffkexnlyfxhvfzl{vfkigfi{zkizhgkeigzfmgejegmjxznzjz{fkgkyfmlz{y{wjnyez{ievigwjik{{feylzyjiiiyjhzz{{hv{jvkiiixhezfexnml{kfzzwmlhg{fjemfzvfgvwkknh{eiifehgeggvnfyjhxyyxlynxjmwgmez{jmh{j{gzlnnjkfkfxhkxymymjjzgmnnmynjvwjgvlexnw{yii{l{nzzwywy{iywwwgzjxylkivyvj{izlhkzvjiezfmkmwyzymlvlzfm{jxexz{kejzfez{zwxfzzjkyfezzly{hgfgwhmwzfegimmjnjgxmwegzxnlmfgggihemnhzz{kiimzz{izfee{x{gkmjizxzzjkjxyyznfxmlfmiiy{kkfizwnw{nynjxhv{enfjkn{{xji{lwfemivv{njkkhvwyy{kgwh{ivfvhvwfiezwfyh{jjgwjzfwjgvvfkmgkgmjghvz{mhjizfig{hzhw{{jmfwjvlgxjkimekhxhem{{vwfnw{jeimnvfkexnjznlyykkyjevfejmww{lgggkvlfejez{wfiz{h{vzzggzfemn{gghefmnj{nny{e{f{wjxyhgkjewhjvevhgkemnwyn{n{kmz{nyvlvnnygiyjyhxwny{j{j{f{kxlxhjezjvljefziefgnlnyjx{{yhvlyyhgigvf{jzhxwfiekimmnnyzjfeemzyyn{knwwfx{izge{{yyjefiemmnfijemwnwnlgxxj{hvnml{xnhjvm{im{k{kmwekhizyji{egv{eixmnxlmnkizxvfgxxjekmykimyigzvyffvfe{ezfvwyjeejmzy{efmiehvwlhkvwjevnvhxhnlvh{fwh{y{wiifexwwlfezffxz{hkezzhvjnw{m{wkezfvn{hfzyyvy{v{wgkivgvxfgx{wgxmywfjevlwl{ixwvjgehxjexf{wkihxvfx{ix{{zjemgg{{xjvnynjiyfnfhiemzfvjnyyhkknjznyngew{x{{z{givnnkgznkkzvevkgkijzemfkikyjzxzvm{{lkijkn{vymwhmmfhvzvigkmhxigkivhwyjenn{{xjjzmwxfn{{zwyzjz{yyfg{i{wmjn{jxxwezzhnwyyjkjemwfgjgvyiigxfmml{hkkigx{vnkiylzziihzhvwnggmfjieekkn{my{xhz{i{yxneejgjmhixyge{lizgxvwxfhmzfezvjemhixhzh{veejgynvhn{fxigyjvjjknl{wvfmjjgeejiggwj{jegeefefxv{znwnjikgwhezevixw{wfwn{lmlwnmjvyzx{nyfjkhgzlmfeznwfiexexfkynnnhzhz{nfmezkizjekgz{y{lzw{g{yizywiev{vjww{xkkvwevwyvfgkhgfgwlgg{xnlhvimievjwn{lkkmlyngmgzw{ynevnfgefv{hhkexmjjxvh{yfkn{gvvwem{nnwfg{{eejv{gzv{zvlgkxnwwgmzwxhn{{fjeywkmmjiijzzfyn{{vw{gzjzwwj{ige{zjkzvmnw{vhfieg{x{h{gikwnekggfewfkijxmfml{lw{hx{{eezzhv{gfk{m{mn{hvfxeinlggjxmlznhijk{jmnkkikekylgimwkimnjxhew{{yhmwjgxxnjvnj{jn{zz{xfixnnhwnzyy{jvjmzzheyjnwkgfgevnfnww{{xwnywemkiz{z{vl{yzffmmyzww{jzx{hi{{hkwy{gwhekfgmhfv{mjmnyevzwzhxjn{mfzlfxv{wj{gnfzvvfwlxwzn{jiggvzzexww{ww{mwgkzyfvnfgmfkjmz{{zignlwjfmkknygg{{m{v{z{vhxyjmzn{jjzezwlfxhzzjgxjgzfkgw{xlhx{izvkk{hezzwkmwhnfxlgejk{l{xw{njjmwwzljkkgzyznnfhegvfzhxnyvyjeyjggkevnwjeiyl{l{hxlfvmlgvmfwyznzxgeezfzvw{lkghmjgiknhvn{w{gjmgiiznhnl{ezvzjgzv{zvzyjzyjnyfzxnyy{h{xemxljkxyxlzwezkkwnjgzfwjhiwfeekm{hhzvlmhgvynmjfzheyhivxjnfv{{x{nnnvny{zjxnnlvlvlvyzf{yzjwhjix{kkgkfejggeznfzggyfhvmjhgvnimvhnhfxvffvkkww{hkkvjeveixfn{mwm{{k{k{yxwmlfvfkjizwgxkizyhewjvjzlzlhejgwnwynw{lfmjkfknjxfnffkfgzhezexnhjxnykmzznhfiie{{jxnyjixleejzyyw{whfgvynlzlgimfkivlvwjkxljxkgeiz{xwm{igywmnhkfmzxwygmnj{xikke{mexy{jijkhzjxikvwzwhxmhhmm{mwynfvzwz{{vfkywhe{fzvfgfmggmjfvkgmlnhvj{nyjx{exiv{zggwjhmwf{hgmkky{kgienyjv{mhmfvhvyliieiyjixkmfixwhmiivjji{iwjnn{imjyly{egvjnyfkfinyylw{yn{vevig{{mnvygg{jhiwjw{w{my{wggevvhjijxgkywjgkieghvgg{hzygvwlkiwyekfeekkmfgnf{w{wnlgigiwjgxgv{{jznjevmnekxhmjvweixnmwmhik{w{yvhvlyjnyhkvwgi{ngz{{kihv{hfznwynzlvh{yegkiyjwnvywwjenwggyjfehz{j{jhex{vhhiggjzjiznw{gxvyjiwhz{z{zjhejmhky{wjjzji{zvhnnmwzwmhhg{wiigkezhemljmmww{yjim{vexzhivfkmlxyjmn{imfgnwy{egiv{ehiwlnyywwwhgxfy{gmx{ylvffm{vynvyzjmymngeyfwfxnv{yy{mzznl{gmnzj{zwn{hheywvh{fkmynixx{hizyxfgg{mjghk{wxhhg{lfeegem{w{mikvyvhhxzyvniijg{vgkevvlgkmnvnn{jkfgvwzzimznxhzxvlgejg{jhkiz{yhk{fgemwjgzjwlgvfivjnjy{y{{ygiylgzkgixgz{fvwz{fxek{gxw{xfx{vjieevweviikekey{whhezjeifgxnizfkjmki{xxwivjvgvimwwzlmnmjyyhz{gnhfiigwn{kfeizhzjzgmx{ix{mvyzhvlzw{fikwnz{fkemjeyfhmvywjzwgiemvlyljkiieijiex{vggnfhzjiiihvv{gmmw{hjmv{vyhxfgzxjmiezz{jmlgvznvn{v{eixzzwhy{ezmjfeeix{zznjkkmh{fvlyl{vgez{gvexznwfkmzvizhkzvfimhm{fkhvemmjvhheheie{mn{vffz{hmwievwmwnwzl{ngenhhkyyjxmnegfzywmh{hfgemhkevznxlzzjmvwmnhgzfwlfi{h{nznhifvkgjk{{vhvjjiizwjhevnkizlznylemjvzxvj{yheevimiijky{jezvzzzwizexixnlegnl{fzykmkmwnwwn{jiwnezznhkvwjxxlyyekylkk{lnlexivzjwwixmlvnhewnmfgxw{iikkixhmgvegz{{jhijvgzje{k{ygknlnhixnfgkvj{xwnhzjihiyyfgkeee{lgvvfyhev{hyfwyhifgvlki{xzjvwzn{hhmigzlyfzwgx{gmnmnjzgifggkgxnyv{ynyyvhxlgeevjixyfvvny{ie{vgkmw{lekeihxkkmn{jkkxjgemh{v{iyjmweex{nnfmynhigxnyhzfxyjfe{ewjyj{hzlhz{n{fhinheg{hzzxjnjivvf{ivykmxhjkhgikfzigvyvlwffk{kzxevwhggfkezkkjmjijzwynyxfezge{ennxjm{wlyjmln{hiyjvjvjfx{wvjvnwyevfez{gvegizkgexjxkmzny{nyizee{wyfiiizywji{lfmixnwem{nhg{vnwynxjhkjm{xkiggimy{nnkmmwfgiizjwyie{jighmjzmj{mjvhmwnmyzhvyfewynynyjzivjxfgwyzhizizyl{efifx{limixgvmnv{znv{{wmnmwhvke{hwlikvfjkhmmjivjevwx{imnln{mhvl{h{fxhvywn{iyyvwyywnjkvwjxxwnyy{xjfkjemjxfgxzy{vw{kgjxnh{lvngznn{mnjgzex{higjxz{nj{{gm{mz{zzfinwwnywjgjzmnwjyfgxxyjzvwmlnyhgkkiennxnfxzzivxnxh{{wfgmjegkhmmynyny{fggevzjyhy{xhzzz{jz{wzzyf{iwffzmnjiemmwylhiyjjvnwjk{xfiekixgkwykgjmmyfxmfjgzy{iheiikkjzxwjkyjwjezhxgmxjgg{h{nggezjznlvfgikigefzxnnfyjv{mjylkkzzje{xhzwnxygknleveeiv{zfg{hzjxyzhwf{jnjgxzxzwjg{mjiivgmyl{f{fyj{fkeeehvfevj{kv{evzwfvjg{gxhhe{e{lhknjjkxyjiikvlgeiviexhxwyhfefieihvgghxzw{zzlimwnexvwywgkvny{xfnhz{xl{mvjyf{h{ffi{fkmjghxzhxnjxjzkkzfkimnzximhe{zegnjzhii{mhegvvfwymnvygzmlzzm{zwzynfnfhmzzfgxhjgy{gkwnyjigwywjzwwhzywwigiknwv{{iz{{yggkmgkwjzjjkkgwwwhwyexxlyf{liike{givjgyhegnl{yginjjk{{vhzyzlgv{nfxjznjginjkm{{{fy{jkz{ezii{zwh{hexny{ezjfk{yynizynvjhzjmxjzyznvfzhxfwjhx{mfmxhzwyfgieiwfnwmyfzxyxfjx{inwzhvfzxwwjevw{xmynhvlegznylhmik{{x{mhjxvyekm{ezmlimn{{hnhzzimyjwnhznwfgxwznvjievhhixfjiemhxmlgmfmegvjjgxnwygmikfvfmhxmfjikghejkjvhvn{hvmfxjyjvnfi{x{zke{lnwnfvwkikkznegmhvyjkiexln{hivlnwnnxyjgwwjifihi{yegek{i{zizfgggzvggie{ifgvnynfm{lgxhv{kgmzjwygxmynyww{kzxwy{{zn{{jiezwwnh{n{ykiizjm{w{zkemwzznwezylv{nhjvjvwywfheim{{nfylynznfmvjwlgezv{nzyfihzml{ly{iixlhkkgyjemxl{hfefvmhnngggmvwixmwxyvykmgvzx{wxwjkn{fevh{e{fxhgmhznn{mv{yjxlimjgfkgmevfe{{njmhwn{jwy{{xfhz{z{zvhhgmfnywn{vhzimvhgkkiywzlexgvhewlnfezwhyjz{zwvlfvkk{xhihvy{vhz{zxmhvnywzzvww{hvvyiejizzjmmjimhenjhxmynwwwig{y{fmymwzfhmgznwiimljvkkz{egjmvnxyyfx{zymfvj{g{xmnwfw{vffeyyezhkmlekxhwymjvlnfvywfnhhxxjhzz{kmheyffzggzf{vyleehifgnnv{jewl{nz{vnnykifx{j{jvwzjwfznkim{ixnhzjjv{zjxml{fynfgzhjiiivy{ky{zfizvnjkkefvigiifevhnyjvhxv{kmyjjgkgkgmfx{eifm{{nnnwkeynhk{vmfieznfkixgmyj{gfxxjikw{yffknwje{xw{kijz{{kggvzwfvjggknfzwwn{mvhfveiivizfvz{nfzfww{{kekevjxwex{ywfnwnhwyemml{gexfvnlhgzjnfezwwmwgxywmyemhmexfivwnygijkyhyn{{hvhxfigzhvylfgzx{zvwznxhm{vlekjvwfkehxfkgxkiixhx{khgyhfx{vhxkegzxjgxzjhgezkmfgxlwliiznjinhyfmwmhmjyjwhvlnwyhekxnigjeezmlzlivnlhvimggkejkz{xh{xegevkijmzfzlwlfkmfzlzj{jwhfmmwzxhzgxjgeevy{evwmyzlxwnfxnyl{xfg{lkehxzjzx{g{i{lvwezmjhm{jwhee{wnhezevnwgmjkkgfmmwnnzjfgxlvwjgzywnm{xnnwwlvyegfeywgzgkfkfikixh{lyw{fegwyvwhg{ifekkvlfkee{{mhmljmhmjvexevexhvznzz{ewwhkwhmfkmyhhvzjjehgezzznhvhnlnljmnlz{hgmn{ievzn{hxfnneknl{xxlxnfmmhekgkxwxnkkzzkegehkkgizfmnwekv{hvhxgxezigzvvn{lnw{xyhjvxlemfzeeiifgheji{nkexhhmnjgx{fxlzjzxkigxjg{wxnfinlx{egmnjexjvyy{vnvfemiifmhvw{yjnfkg{gzxke{vkifzexmhkivfvffgfmxlxfwhfvvjfzz{fmw{zyxlxjgkixnhgxjknyjzgzfkiifekmzyzhvfxjxfmlzyvywfkgexynxnvjnnxw{jmyjijinfwngeix{y{geggm{wheemjmzwzhjgyfnhyhezizxlv{njnjyhevnnxyzxn{kgmfwngkjghk{{{fmhjvvl{nyfizexynkgjmgifmywvy{ewngmkevfxnw{mjhkixvlvwvynhggekignfwyiejgxnyn{hgzx{jxivhgiez{xlzz{ffijevyyhjxmhezyjjvzwvjgzhxzhxfhijxwyhmx{fkkmmlzy{fywvj{hhmxyyjfvgvjefe{vzw{ieeek{{vjjmyymlje{lhmwjfviznlwfmwgvny{fvnhieim{zzemzjjekkikjkevyhyfm{gmiznjjghmegynfgwy{nn{vhw{w{vjhxvhexmlvwwjvjkmhgkixwfvzlfijgyhxhnjkkjznjvnwwjknymhnw{enjjeizwwzlkmwh{zhiwwhgvnkkxffg{y{{gkxlnynwgzvhexjizlvnvwxnzjievyyygiji{fji{zyy{jikjxzxwhjkegggz{njivkmjxjkvjv{gi{{ixnnfxwjgmvlkmwwxwyw{nfenhhiizmjjxzngmikfehxmjwyy{hggeevggjiik{iy{fmfzhixw{vikx{{vwjvnyhegywizynwjgvixkkkmeiz{n{kk{j{ffkkmnweezvhkmhmwhz{g{y{hxwzv{f{gyjezjvigfg{hxlkivlhifxy{kgkeyjyywywjekhmxhgzgvnjjmem{zii{{hk{{zjw{zvwfkmnhwnx{nlyw{nfxhxheeejkjxzh{ejmz{jijzjgfizw{jxlfi{jezee{x{{iznlivyjgmxlvlzlyn{m{yie{yyyyyn{jvwwjiznzzzvzfem{jzvwymygmfvzffxhxgxnyeivjegxlzzwwwhhv{f{xwynyzfeznnywixxn{lv{fmek{vz{yhkexwvjvwfiyfje{efege{zeznnxhfvzxwyezgmvy{eyjzximfv{l{mjgwnfenfznezgkge{vkimhkm{eiz{iezexig{eznwnixvwnnhxgvxngxxywwiiwyezm{vlvhmjfkgg{fx{jvnfkmgvvhwfienwvy{kyj{wzljz{xny{fn{{fm{mlynwhhihkfgimnfn{vhhegknjjxhzgxigz{{whigezwzvmlzwexvnxyyw{ymw{ggggznwkmwyezfiemnlxjnfzn{xig{vjgzyy{zzki{nx{giixmnhmiz{lzwwjhehkw{mnjgmnjeiejzywfv{yv{{i{{zhkkyhegmyzwzyfzezwlyyivizjihzgmmfjkgzxfixjiwjggyygmzyfzvwzjevixfgwlmlhvfxgkixyhheieznikwjvwgzzvyj{jzynnmnhm{lixm{wlzyiz{{gzivv{ynm{jejvzwzhfg{nmfznfvfvjgfvexizvjkiikeiizw{xfnl{ifen{{zwy{xmljgjvfzwymfm{yf{vzvzhzfixggwhhm{ekeemwwgihgmyfxkmhmkkfzvjn{yfyhki{{vnfixnwlmnwl{zixmwnj{eevgzylfihmxfnwein{iz{{whnjkifzkkmlevxnnw{kmhzxfkhehzyjjeimhevniggkkkwhgzfexywnfk{fz{{xxwnlnhkmznwlznjgwhz{ikzjhgvf{n{xkmjghikm{lkiyyieekfghxnjimizzwynfgjggvyfnnkm{{whmnvhhzyyzfvfzfznnlwlvlnfw{hgeznwigvfz{wyzx{jigimwhfxwyylvjwwxlnnwjxjmjvj{ykev{jmzhxlmwwlgifigxvymlev{m{nfinw{xnjyyw{fx{fvhhzhkjmnlgixjivjmkiig{hixgghzvfy{jiy{m{n{exfvzxiv{hzngvfm{ywynhmfn{hkyjvjegekgkvhzzyjfzexjmjzx{{nyhzzgvnh{gxlhxnnw{jexfix{vzy{z{lfveezywngxgz{f{fjvmhmjzvyynwxl{whvjvkkhzxhkigimwvyml{heikejggkggzyjegxjehzgzmj{exnzvxligevzymyw{xhnygx{j{fvy{ggmgxz{zxgk{h{n{fkmwfzhyfkggexhkmixiiyfzwigznxnjmfvgiimevmh{kzzfznj{kizzxxhekn{m{m{jikmfekkzvexjgvjfmzfmj{ywfhx{{wnwhzf{xhvmfvjynnnexfe{gvyynjivlx{mymhgz{nzxw{fz{xggynwnm{gmekmfmffznfvyke{fjgeifvkgek{zxjm{{xgemlyfjgzniknwigkegvhmyfkmxffgimxyz{yywwfeznzvyw{vx{iizhivmhwwzn{hmfkigxzlxheziijevhjen{vfhenfgziinhjikemjylvjmyhxzhjzwyzzzxzhmfjmfijghxjzgenlfmzhnwhkgekmyfjemwjxzzkgzx{wxwimmlx{jmekmlvn{yimjiiexlhinfnwxlmlxwy{{z{evlzwxfvjkizfz{{{zljmwjmywh{kzyznzxjkkewnynhxn{kehefvigiz{zy{xfgvixnnmhv{v{wwmnvjiizzfzfmzw{x{vjkfeynx{{ykmjvylv{{hkefgnwwjvjiv{hemkigez{{yfkwyylmyzvylvffmmhy{ixylmynfyfzw{fkmfevwvjmlmhjg{vx{ezfi{ezlznyn{wgvkmkmjzynfxnyimix{ewf{h{m{fwnixxjwwm{zxfm{mjkgzgefxznnjzyjxnffiwynnjkwnkinfyjgezvvnjk{lxnhxiveijgnlvh{hyl{eigxjmhfehvwf{lfemfzwfxmy{evjmlzh{nhgjxhimf{ximgveinlgkw{kkjennyfgv{h{km{vh{vgv{mzjwjeifzhxxlzljxmyx{fiwjw{{lwlimii{x{nnlvnwwzhynxnzzwhznz{wjzy{ijzjm{kmwxlggxjixhmkezv{gjvjzvnkky{yyny{my{fvm{fg{zkeylzfwfm{yfvjz{jeigyjvfjgwlzyzx{hfmvwy{{wxykihgevyw{{jkwwixezvwhxzjyfzjkmikjmxlkmhmmjfxxwiewlhivffv{leevyzffixwkkvhmlnjzzvfeehmgggifzynywhgyjw{ixivkmnlkgiixyemimgxz{wfznxngzx{mw{fylienwylevwyvnmjgkznjxgkfxnfhv{yvwxwzjnnhg{i{jfvkehvmly{hvznzj{imnnfhgx{{zwwiekkfxkgem{{mw{iik{njvxlemkixlznvw{wkm{gki{zyfekmnfmeifk{lnfyj{xywkkvhzfwlikhvwfkexh{exhhkxjzzjx{{jmn{{hzwjvwj{wixvnev{lwlwfgkhxwleinh{iyhkkvfzvjxmfjkivevvwixix{kyf{lzwnwfeznieeejkfvyfvjjzhz{nxh{fvnienyemjmfgwlvhz{hg{ywjwjgvikyjjen{hvkggzfgzxvf{ffkww{zvfjxnn{vxjxnjzhevjivfgnlxhyhfiz{kezjn{{leiz{{e{mv{wnivhxwwxjx{zjevyhzlxwjmn{xyylzhylwwixmnxjfmii{xv{fejkzyxliixynnzfvwgmxjfg{gy{wlhzwwmfiznwyw{xjkywxfz{wwjkjxjkvnywvjemzw{iixzwgvnlix{y{mznjxmnmwnwhvzy{iv{zhhzfi{nwln{x{{xxwjx{lylmlex{veiyfegfiznfm{yzhmlkgmwzjgznfhgx{gvxjjmmwynmhjkwnhikm{wfk{y{nfgfgjzzwnwjv{ywfnfyf{xzwvfznixxh{mwwxfylekivxhmjexegzjwfyy{iem{wekkenygxvfnjxnkevwivhkgmzywhnjfk{hjmigvyiezjzjvykkgvzwhe{jxyfe{jn{fmxfw{{gnywyxjkezlxywygiixw{nhylzh{mzl{jkmzvjgywjveinfjmgi{zjefgzyfgfvfgjeegwjhxnn{zfifgizevjenngkfmkmjiigm{{ixwhgwf{vimvnyfhvmhmwmjjgggvjzlim{xnnylmnvf{gyjgzemxngi{vhmkkxfyhmlmhizyjxlmniiyf{jjimhkkev{lvh{ewhnww{vfy{wfvhkm{m{w{khe{fnj{vx{mjfzkmyhyymhezfzik{wyljmgvggv{myfezvkgwjxfgmz{vlhmevvfiv{jwnwnnhkmgezx{mmhvwnyiim{gmnjfzhgyjivvnkifkimnyiz{j{geiz{zvnw{lw{jkixfiyjjzjmmnx{fzjgnymyn{wyyfgmgmixevwh{jiijewwwfjg{e{ngzzlxhgkjzevw{{xhk{hjezwvlnfkk{yzxwyw{jeez{zjv{xeikewygmnyiixfwnfgfvjgiegxnhemwymnfvvhn{mwyhxjnyzl{z{whzhgzw{nzyzwfviinh{lkkyhznjegzzljghkimezfmyfgg{jgxjzzzxlhkzfjmxhkixyee{zfvzzjx{gmh{fxnnngijkznmniihigehxkmnwnljifiikzlmfhzhzkmjeemjihzx{ekjmvyim{ejmjm{gnyvy{nwngg{fvywnyf{nezjiylnwvlevezfkizexvyv{{{egexjxwyzxhgzzzvhkylmjml{infhzyljen{jmixkijgjekmvfzzn{zyfxnjeijiwwnleiv{izy{nhjzvjkmekgkjgfekknlvffgxyhx{lfixjxyjmnlylfgfvmjyyzlyhmyfezhwngxw{mljzjkkmkevw{k{hemkikekgwyfmzjwfxym{vn{wwwjeezm{vjjzfekkiexlxl{xw{mwy{{eyw{fxyhkmyixyhfkyhik{kfghx{{jgvnxhxnm{y{wfkkmlkiim{hfizxgv{jww{yzxyyzzememwfvjkez{ylnlke{gkezngemwjmzvnjggmwmnz{{xznzf{xie{jgkzwimzzm{{{kgzfxfzv{mvwzxmj{vhghvyfyhnfvlyyigzykiyfvfvjylyffzfmw{jk{nhzieiijinlvh{livgehzzjfekeienngzezjzhmegkmxfz{zwvykewlnlfigxznzwxhexiieizhmywyfvvlvhezyhyynjm{njgenhwyjemnhmfvizwhyyzh{vjzgznjkiiivfvfxfeeyjvl{nn{vj{hgivfwlwhzxggnlfehmmjjejeik{yhmfezh{e{z{zeim{nfwhixjkn{gzvl{xmjwnxlzyyyjz{eyfwywfjgvyhg{jemignhwlie{zwlighzkgwh{ixn{z{m{ljgiievzlkk{xzlnwynnygxfeynxwmwy{vlhgeknlje{lkemyyjhkevgkjzeeyjxnjeyhzzxlzn{feghmjmiijgnjexikeznn{xhkgm{wjefvxhwynjkmmfxfhzexmh{lnygxzjvwim{xnwkehxhkigeziijxevgvnhvlmyv{vlmfwhzyfvzy{nnlx{ml{ljg{yjknlzl{lmjn{vnkkkeywemhghevhvwzhfgn{hxemzzgkv{jv{jkkxnv{{iyfz{{zkgvjkgxnzjwyvlxhizmjwyvfzwvl{y{lizywikwl{nmlywvfx{vwvyfiwfyywnnwzlyf{{jvjk{mjvywzjfgnlfkzz{ijzyffeezvnzzegzj{zyfgk{w{meegeheizzfkmwhvfei{xwyhggxfzimjmyhynyykgwwv{zwywzwmnnyimjigmhxvwfxyfnjzwevywiihkmwhz{yzzhgnjfehihxzx{wgvjiwjgx{gjxjkhgnjezmngznl{fix{yegjkml{w{mynnljenw{n{{igivemhvml{wnw{ezjvnnliiev{kzffmw{zvz{hgvhjk{gevgkvlvnekmjvnwlzhki{gywgmgmjvynezevjxgifgivwynwvwynggznggyjzfxj{g{ffigefiizfzgvmf{w{hexfieeke{vkk{yvh{gm{yywnynzlfkkijmgmywzzwwji{zmhywvfhkjgzvxyexznmnhvxhyjgmvfiznnvfgeeggkjkkk{vhm{lvf{izxzx{lzjgiiivwxhfxvfgmzwzzzwmlyfzvfvee{lizyyxyxhevzf{ejx{hnligmnvjie{yfinln{vnjzvwvneem{igmyevimvjmhzj{wegnljzwnzhigjg{wxwjehmxwnljg{kjmvhnhhv{wjkke{j{ygenwekgkxhmnzwiiivvwjkmwm{{z{{vwnnzjnnv{vfwyfxnnhe{jekjx{ez{vjzzn{gm{xy{jiimik{fvwy{hvexkgizfz{hynnfzznl{ffifzyn{ywymj{wgevhjxyjwlzhhk{nwh{ymwhejmjkzwmfzfzzikjvfzjgezx{y{egz{fieimnzxnwxnvwwhjm{hx{kmwnnlfxhgjiemnjggwwvjevexkiwngg{fexhvyhvfjiigfeekwhgiznfeekzhmlwlkewfjzyf{ikg{nzlwfnyivig{xmfhkeim{gggkn{whnjikixjgmfivwnegynwwkkgkzyyw{{fkxyyhiiyhvfixylyfggjk{ijvxfm{xwhifgzymlhenhywnlgkzwvyxyvjkkmyy{wh{{{z{{fx{xmjegegkejv{fjzzngxjkkmik{knwzfji{vnjfinfmnxn{nzwhenlgehzjxie{hivgvwhhemf{kjvw{hieezvvynnnhjejenfjvgkvyjehkezivfkjzmhw{zzjzwhz{mwwn{n{{vhzlz{kkgikemlfmgeyljmikwjxhfzjvfzvn{gigv{jgimyjiinhmhnlgevw{nex{yhv{zixjzx{vnhxexxj{ykmzwgmevzx{hjgyfzveghkizxygggzxhezfemwv{yjhvjzemignnnj{iizjxhev{{egggzizy{{hggvlznxfem{ligmfkgnwwwzlizhi{xwffkzfnyjkmfnlev{e{jvfn{zzwyml{jjkyfekvwhi{lzyhmzygkmjznhgzvexjzmlnwzhfeylmhjzxhiz{wkmn{fxjehigxfiikimgvml{wxfkmjkjkfgmngzkehm{xjk{y{givhggi{mxy{yix{{gkemkghgwywjfkvliexlnjjvjx{i{lvjyjy{vhnjnlynvnywgmyfgv{jikvyivmlvynwnl{z{l{wzhezkg{ygxwlwhnl{{evggzjzfhimwnlikkezvwlyhzwek{yxyiikmwwzlzw{xynnwnhwnnlzlwnxjimvwjehizznyznvy{iyjjk{yfmzzjgmjzymjfievznjkwhn{igjgxj{ifmxhhm{kyyfi{izxfgn{{f{gmfjzzwhmfe{m{wjkzlvjynxj{kylwffznfzwgxjkjvhkwnvnjzx{zh{zjgvnggivexhk{wexzzxjz{x{vnyhynyyznzhv{wfyjigjim{w{jvzhylzjwf{gywekzxfijevwxfizzhzh{xem{wyheieghzzxmhfinfjm{hxjnnzvzwylgzvlxhmhfgzjxjkmkkzwkikm{mhm{yyjigzjvh{jmn{izhkefkxwvjnljximy{hxjxexvhjvxywyynixvy{lw{fgvlxljk{ifzfzvjggwyjefvvnfxzhxlfxmhkmei{ky{wyznzy{mzjzxzhjvv{znfiizyy{ehxzyggwn{fjgmjzxnlnjjemnwlxfkiixhzxnezgi{ykkzlexjzhgwwfggzznfvxwyw{jw{ekxjgxzn{eeexhwlxf{{emiiiefezw{nmwxfzlevjgnliziiiezf{j{wzhnyw{gxix{gvy{kwymfynxjhezwiifghv{l{hmjnyynzxvl{zixzjnhhkjmz{zwgiynnlikyhmf{jwyzxjvfgjgyjkmwngegeyljxjxfeje{x{g{yxj{kiehx{emfvy{lexmffgm{igmygx{yzwkmeeiv{infhkje{jzjivm{hizhfm{{{jemkgx{imxyjmge{ehknlwwm{{{{fjkmf{xvfn{{jyhwwezjxjmxnhgnyivzwhzzvwn{yfkkkfv{h{{mlfk{kfxjxmjjmhemnnwjehefm{zw{gxkifihzwyy{zxxfmymjfxfmzlje{eyw{ywlegiz{kgg{w{yvfjggg{hivn{mjjvigjzevfmwnnwvhmhxwvnhxzxjihmzjgizhekmyz{mnev{j{m{yggmlxymykm{kgmvyywegjkzf{mzlv{vly{xy{injjmxnfmixxjnw{mzjkeyhwjhx{nnfnnxhixy{ekxnhmn{znwnfxfxmhigivmfw{jx{xnw{hkm{zeiwyvhhghegznfiejmhznhzwfexljmxfixnlixkggvvfzvezgvnffzhv{y{fn{{vmynwkegvekemxlyhfi{zexvjivzhnyfk{iimmhynzyyjmjiekkfmigylfknjgkzfxh{jevzwkmfzxh{gynxheewykmvlevjefzjxvlvjjvmhfezywlvn{mvnnlnh{y{fjghxxwnf{fkggegihzfizfiimfjeivvhzwjemngzvy{w{z{xjixhxj{yyjhxxhzzkk{hggxnvlkivwzhhvevemzfv{kgn{yn{wzxwlyhiifeylkkmlkiyjwjzwfxgvwhignwmw{jw{ynznzh{mzlzhkknny{vfjiy{jvvlfzhmvfyn{vki{wv{mfnhfinwkk{vkgxfeijg{x{lfvzlvlfmmf{fix{mnl{lfgmyvlkiemexnymlywevxwnhexiveezv{zywn{eemjylkezxjvnwgmke{ymnxw{h{en{ekn{jkjm{hxhywnwnlkgjeeg{yxfxhzy{{fzkkynn{yyjxexfgzxyw{nwf{wyl{wvj{{ezxhwyfzvywf{h{nnymjhxegkmiz{iigggxwegwf{vgi{{{hgigexljzwymnjiivzh{gy{xwnf{mxhnffmgvzhn{{emyjvgez{{wvwmfjz{gjinjjz{lggyfemxffkfgz{einnixfehxjgjejifkwlhezxhzy{hzmhwwxf{hgxivjiylfinjwlyhzfwyvyxlzf{kwy{hfigkyyhejzxnwnfznnnwzzhx{zx{jzkmgkyngixljiwwgevjw{ee{eyjzzhvgihmzffvikikyfvnjvxhylyf{knjmlvfnyigwnv{yyylznv{ynznvlkmfxzjhgkkvfynmym{ek{xmhvwwwgz{fekhem{{mee{wixex{xhgwheizvynvyzwhejgvw{yggzwvnki{gzwmn{x{nxhikem{x{zmjynznjxfgy{{{vwnfgkhvzwjejx{whi{xeknlvyyjvf{ngm{njezhvyjgmhvnzyjkhi{izjmfzwmjivgzz{wwzy{wkkjikkwlkenwnhimmjfmwf{l{yeexhfzex{zzw{jgxxjmfw{wjzjzlzfjxzjvlhxkivjgmigvlvnn{xwkgxfnfhzznwwyy{jznem{gie{lxyfxkevjxlxlnn{w{gfmjevhmffv{f{nvh{xjznhvfkgggzxxnjmmh{{im{e{ygkjejxnhmngvmhm{ynekjehvhi{lfkwnekjxnliezxmfgi{jn{yfnfjiegnjzfnhfzggjikkv{ivhi{mnjeznj{lmjzxhegi{zhi{{jgwfkkywzngxnfvfzxivivemkmxwemgvizmjnh{{{lyyjkezyhwhyfemxyjvw{zvyfimgihkxnfmgkee{e{lfkjvieemxh{gexikvjyhizgkwjkez{wwevfejgjkjx{kwynhm{fixjmwmfgkkkjxxhhxnjkezzyjv{imzwixn{eggxgkkgfzz{gg{y{l{jjghz{hgvy{jiyjkg{nvjivxnfe{{kmywvfjxikv{whwyzjfkywxfevw{njgifmyywnvjgmzn{{kieggkgigzxfnfkimnnwn{fkxl{h{ievjg{ezzixzhxjig{zxwz{ivhmgxzlevzlwhvljxgkwnxl{vzlfvegxnigjxzlzljz{yhgegx{m{w{xynwylfmwh{mzv{{imvlzy{limfx{hkikmnligjzgznlixhgvnzn{nvw{lwfeinjkg{zjgeexfyfwheijxmlfm{ifkzj{x{zhijmxj{lyjv{eimlzxmwjkyjnw{vexmyzhfzfxx{vyhgekkihvzjheje{nnl{vhifggmzh{jgzfehgm{fevy{ykgxlwlzxxyyhjezzw{ny{lzn{jikfmywjmjifivwzhzljkzfjzkmvlnfekzheezffvynzl{yevfmnnjvxwgm{fivjvzfvn{ezfivyhiijxxn{xezyymwnnezxnfzynyn{yekz{{zjehiizgkfkxf{wjxzvjvfgee{x{eznhizh{nvjvjznvj{iiknjhzvyhziigmz{ezfvexiv{zkgnjimkmzligvjjz{zizivjxvlwlnlnlhkxhvffxgiekkmkiemynw{exxywwjmxnzy{{gvny{g{njkynx{izjvjifmhxfxgzhekinj{m{weevh{{ny{nylhejeek{x{nxnevnjexievjnymwez{viizxee{lgkimnyjkynzfzngmyyekw{eehky{v{w{fxwfmhzzmhwfjigzexkgkmgkw{{wvjjvvjyffxwlhzhiwyhe{emwyjmfzyhgfigvvfnyiifzy{xlylnyzn{ifzfi{ixhhgexjmhkwwjvzwvhiz{fhefzzyegvyjmkgylezzhigzw{l{xnyfvkggzmfgehevniiywmjhmgkxhfkzvzhm{hzjxezxnjgkefzgk{zgvfkhveijxexwyiggijvwnmfz{zvy{xfmjeejmvlzhm{zywwywee{y{lyhfkhk{v{kfxgg{yznywjiznxhvjyljigxekvyeeyl{jyjfgvfhxigzyjen{x{kkfenhxhxligny{mvnzvfzxwjknjhxwnjk{yjkzxivjxmn{jkmzvjxgmigkiigwlizynzweghkmjjexfjxv{ezikjigg{kzwzfw{x{ekfvhvxwhvfgv{w{vw{mnlvjfe{lw{{jwnvlhzmf{niz{jjvgimwivxn{lkmzl{x{ekgyhfgexfkigwnzyiziz{n{kkm{vwl{nmnvyvwxfekz{evemzwkkjiixmjgmzwzjvyiigmnhkkfiem{hfvjxz{exjev{hxizvlgimh{yvlkk{jn{giiexfxjfvgijxhkx{nhzxzv{evhvhhgggjmfv{wgk{wxfzfyjeemwfzwwii{nfg{kyyjxjvwhyjjvnwimji{nfvwnwfyyywjmfvfm{heghxjxhzyhvwvy{nzjimyjgvginwhzzyv{{fjxixemjvw{zjgxxfynxfx{{jmyeefijg{wjzxnfmnfekfvmjjkjvyl{gkmkixlw{ji{mhzkeiegzmh{kyfgzxyzleifeylnhynjvy{jihzz{mhwyimvjwn{imlfkwhx{ynxjezjvwhzyzvivfzwjny{{fmzwvjxjmy{{wyxh{ezznh{vzlmnwjmjn{kggimwzyynjeyjynhxm{{mwfvfwfekhkvyvyhgnlxwiijxnnjvjikinhzvfmv{xwnnvlwfjkwnegyyxhivjen{imwy{kwj{xzjvhmfkk{gvhegwfkgvwhiywhkjxvhzxkghmegv{jgvykg{veenyfznnexjz{hixeejznnzwggggimvfmnfvexemn{ylynnww{zlz{jxvlgekinfzvhihixleveziefeiizw{veveeyfkmgmzxhx{hzhn{nj{wnlxjnfnl{hggki{nnfhvge{mhkgeyjiiee{kxn{m{hxhimgggzezixjkeegey{whfvnyvnmwimim{ljzvlxlzh{nhizzev{wwnegwliejk{vkgggjzfiynylgvwfwlivzxgkkmgxw{gknjgkfz{jwf{hfvgz{wheizgvizemwlw{zw{izfnlzjie{nekyfyjzzm{vjfxgg{yivvjnj{vfvkmyjvymnhvzjjkvwywwnzjjinwezyhjkfijxwyhvvngk{ix{kg{{kinnxl{iikfkznivznwlzwwjeegijevnzygmjmxlzngmmnwf{nfmv{ywyhnhnlfxjiw{my{{igyhgeemhkjxgz{gwnim{kwlhgwwhzhxhigvvh{iiexwegikmfekgmemiemfwnywgknywn{fivfg{xyynnyyzn{gxlhzyfgi{wyjeeml{wzw{zwwikhmmyxlyymnmhivgiegnlemeemhfemljem{zwfz{wkinfvyylmw{yjzv{wywn{lmjfzkmhkxjwnmlhgww{yhizxiifihg{gyn{v{jmfvwfghvxljgzxfenffz{{xlv{jxwnjvfmkgjiy{yfxhkmnhznhgwjekwwkmgzheheyy{lmnmnkivhnlxjjifejm{izvixzlnfhzjkwj{xiizyixvwgmggfmfviinjvjjkvlxjzjvjvlxj{gzzwwvfn{fzyfjveewlkkfvgzizekvhkejzevwwkmmfhkwhvw{fgmyyjenhfevhji{wz{hm{vzjkiixexzfnffzggzhjiggv{ixxnxnhkhxggvffzhzmhm{ylikzjnfy{wy{{{eegkmgghgjmhmhghmixhkzxivfxienlgzimzx{kjzxnwhxn{lnl{k{xjkzfiznyegm{jkhkei{jxlwfeiev{zxhfgfkznvfjzyj{f{{x{wfxnmhzvizhikmzjjkezmhzh{xhgfmfkzymlvfvfxwhzizggfk{wgzzlyjvhizwj{jvjwlmn{jfzjv{eynzl{iwwhzfvvh{gxyylfmixwljgjmki{w{ejvee{kvlzxmlzjvwxy{knhzfjihzevwhfzvlmjvy{xfevjvnhkgzyhjkheikfgighveigxxnwyzz{nfzy{{{zzkenjgefm{{mfgvzvwh{gekfeev{ewfig{{nfv{znmlvlm{fmfmznzhnjzjnjmjy{{nzy{kznzlvleen{iefmnnvjzyimwwx{jgwjw{y{iehzzvjijemhvnimeewnixvhiziijiikv{zyjznlfmwyjzzximmhmhwhjinfn{hzji{iyyzjjgyjkkizzwwngzxfxyzfjzik{wnwxfhgzwfmkknjyfzzxwhgkgvwemvy{zzyei{wzfyyevivvhhxkmnwzxv{gkjvm{exgxfmzvezkegigihgwyzyjvgemfwlgiz{xyjmjz{mkmxlfehijegmge{hjiznex{ygv{ziixljx{{vhfgiznnekvljejkmj{jfey{yhxnfzezfmzffkfmjzhizfylvn{f{zmf{xez{{zzmhvw{{vyikhzwy{em{ynzlzzizfz{wmlx{mj{nzvezjinnmnwwnnwyvfnhv{ekylnlxfwwvwgk{iizgvnnzngevjixeefmvyny{jixyhvnfvyy{mkiwjemylimxnkeznvwfz{xiknhigiiy{mnfkfgezkmnnjxwy{jiefizhmj{zemiike{k{imjzy{l{y{lzykizyjevjzjylgknnhixljexjynnwegynhgzwv{{fxfxlylx{ikgvyyzvez{lkgylzjjezyxjn{hzhkheimz{yw{lwfemnfnfwjivgezwfgy{{wzfeznlkezzzwjzkgyfyjgg{jfx{eyh{meveizh{kzfexjmvwwlnynnkiwnznz{wlmw{nzfnjvfivzwxlwyivhegkjgkikmxfwyfe{jmhgkigzhyl{hhvgxjvkiylhmje{l{hhkikevhemf{wxyywmjw{fvie{wnyvfgezjzxikizgmiiwfevezkk{iyfhkyjgk{yzyjxzjywyn{yznwfjmyyzygxnwyyexegnjwfxy{gfezjvyjvmfnf{mzzeigeezimfgjkxwnwgggzwljkgegvizgkmfxlzhhvnh{gy{yhz{evjenw{kx{{yy{ywmlxwxffk{hgxginnyfxffe{vfvzvjemn{lhzexeveeke{hxjxlhvgevlgviejkfz{xwfiinlfikegx{jyn{lxfwjgvmyxlmhv{eekewnz{izfkmfheivjxwhkifiwfvw{i{jhkjgmnvy{vjegmezgvwnfvvhkgwnyhm{zyzym{wjex{jyymwz{nl{xfgmf{{exzfxnwnvhv{myex{{kmiizhvnw{ggevfgzjjkywywxhwlkkznyhfmmfyyzfzfiv{xgejizymywlxymwfkvnmlx{jgv{xh{ezhkizhzzfmnhxlz{kmv{nl{h{vjxxhn{xnfxjg{evfiinhizyhw{izeejezfvwgejmhghmhv{zvwjvfiegegimywvfnn{eyngefvhivln{kghkzyhejkmyzzigkkwfzy{njiyfwfnjegm{{imwmn{mhiwygz{lmffejvzliv{xmlzngx{ngeyf{hjmnfikmly{ez{myfzjhxzljxgkyfzhyfvyvwxheewwmnjm{mvlhejkgkyyzwywwl{nmyig{{vfgikgz{jkfejmvyixfmgxezmhwfvheknfvwkewwiziihvgvzhgifizweivwywjznl{vzxjv{ky{{{hxyjkg{nixywnhz{hzywjefm{w{lfvfixfhxigzngvezjzmyfeivmwikzyzhgkmjmyjxwl{ikgxjzzzffmggmlgxv{ixwwzyvlzvxnjmhvgvgizyvnjmgixneegemjzjmln{fvyhiimlzjmwz{w{zyeehv{jeejxekjkynn{{g{f{ehzevwhyln{vhxlhgvnvwjeyhevynievl{yem{nxln{{kjvjixhfeiewn{{ikznnjjgfmnwikwymlhmgxzf{likkmeg{yvfvnzlwwmwznxhnfhkjmfmmheekefghzjgyhvy{evyzlmj{jimvh{lfgv{xfvhekegmfgkjivl{w{yzvjgexxhvjvn{iezzn{zfvzvfzy{wljgy{xwezn{wjznzwgggvzxzvhxm{{infzyvfgxikfvvwjkvw{ggxxjywhkzjwnfgylgm{yv{iiw{ynyhfmvfn{{eiefkyhhkkkyhv{v{hzzxnf{mylxj{wfxv{kimnywemwf{zkmmhylynzyzv{kvjkiemzxevhm{zwn{njgzywhekmnz{vfjevlnl{hxy{{hvgexyfkfzemjgfeggvnzwmlhkx{yfgijkjimh{yxfiizxvwgzfzxhwhgvfxkgikmhemfvhikeywyjhegmwlznzygvxnmhnl{geiy{{fmjywjkigjxxywyjviznhwjmjhmfggkvjighe{wkgzxhkimie{x{xzzvyhvigywhkvnzlhkjkemvlgzki{nwjvjzvivjvivmniijk{lwly{myvwnywlw{evfvm{{iywizmlizzzjznh{gigzjwhggieezikizmywfmnznwhwnnfiiiz{ijvgghvimfxhx{fgzivnygzfi{hkemffev{wywwnlmlkijiixxhgxhe{fzzhegkw{mfgkxfizhgmyjzwwxjzlnhgijivnnnyyimnjywmfzyeznnxhhx{evy{hjekmnffvevxwgmwwyf{fhxgmhmynemy{n{v{ik{m{kyfvjnhivexixmymwgmjkzwnyeghvnngzjeiijgfzji{nyhjmnnhxvjivhzzwhkmhnfzf{fnlwh{ygzmw{i{xyjhxjzn{iijxjx{jhkv{jmikznevimkgiejkfewfhiegkiywnnfznjnlx{zfnljg{wexvynniex{vl{x{zkgwyxfy{gmei{x{mvwgmfmvnwjevw{ixxhmhxn{hnngkkike{ggmhzggylevezwljevjfekizlfi{vn{hvizzxevjizjnwgzek{mzvjimnywyhjgw{fzivnnekjxixz{eiegvwikznvhhzyhgijimnv{zwjgkkxfjkzxgx{izvgz{fzf{izyzxixhk{wzhvjeg{vkmkgxhkenngmzjywzfjinyjmhzfzjx{limigw{exzy{fnj{jmleegxvhv{{ygkiezwynz{{xjimfivnyeevwy{eznhjgyw{lfeekigyfxhgehm{jeveg{kekikxlmwikizhkfxfzegmn{mfvnn{vzlxjyyekxymhgmynx{n{{jhgexywnnhkfvizgi{ffm{w{lmlzh{whzmjexzffmnjzwwlz{hmvjez{vxw{vkikk{jkk{ghegm{jvwynizw{jexn{njmezjvfx{n{gmfhvx{v{{m{kjihximixxjzfgvzwnlheyjyngznhz{{m{kjgkifeje{kjk{vivfvnhwjzyxfwjhmgmvnikw{ixzygmkewwggywzhy{gxvywhxwhmgemnzwnlvlvh{enjxfxh{jnyznwf{lkmmfemw{vwegn{mh{k{vzfzhvnvnnliemnmfjiz{fijgywyyxw{yzfwhfxyj{eggxygxfzylgiw{kexnxjzjmwwhnfmfjkx{{ghxnyzzfizjigwyvwnhylzf{nzxevvjhexfezv{jxeinjhvkegkjk{x{jhmfijznywynnzjvhnh{mixyjgznlnlhkgmek{negkmvlhx{neefejxmfkmx{vhyjmlxyemyjzxvfwfxymlxnnjfgvwwj{hm{gxy{himnivfmkk{nwngk{hfxkkezjgvhzl{ennhkjvfmhmjiyfienfvyhgfzigkmgeiizhyjkghvgzfmnjzynf{jkkhi{jizmhkejiznexmfjgfmhz{{ekjmwyvlgxekjxyyixjemjiziefgmngizfhvmwnjvlevem{g{xwngvjvjvjigzywy{vljxvfkixhxf{zjzzh{xjm{y{givxlvlwnezkeixkinwieggfxhvivjigigxhgkefzyjkeyh{emwjizleeyly{xhzvhxgzgk{{zlw{kg{mhimhxyixikhgxhvffmzhjg{{zym{{h{z{kkk{jm{xwvjhzhgnyz{v{nfxh{zhxekmyii{xzzgmkmjmyjkgnww{ywigfvnwxwxyeixlgzhimjn{emfefgnh{lgv{mgkwlx{fievizv{{kwyn{nlxwev{lvyjgynz{{lzhhvgev{{fx{mnjzezxj{wxffxzvjkmnvwnhz{{ezljmkmgeylzlzxzjkmzxvfvh{emlx{wf{iivggjixhxjywjv{lig{h{nv{jx{ymfw{xyevkinjgxheyfyn{ehvgm{mznhkkkjegzggeexykewhv{jg{xggeifvwlwn{jnfyhzwix{{izmhmfxjixyjx{wy{ygizxwwnlxjgmkkgm{kywgehvnnxnvl{zwwzhmn{zig{nv{{neghvixkew{yj{fmhnyynjmnf{exhgekkhiiifxw{imnjwhivny{fzvgxiezykgxynlhkvjzhjznhxlzjgexf{gvw{en{nweehxzfnj{nm{{{xhjkkivwjvyjnf{vyliviinhkenwxnmh{ljxnjn{zfy{{yfmwwfxjkjiimighxfem{kifvjezwwn{{{nwfkmmfzw{ivhhg{xwwyjfvzwizmwjizzfknwkgekxh{{ikz{ivhvw{wyznvh{{{ejzwjfznf{m{efgkigxvfvlexgg{ywhiz{{mj{yzlezigvwevnhv{{ngxwwkm{ymjexiivjnh{v{ijknwml{nxnxjgizxzlzfggn{zzzjix{mwwjmwywyjijxjxxffv{jmyzyjvezimynfzzfmyzljzek{z{i{wimmhivnfzljxzjjivfxhjkhv{jmfieem{mexiihgxljvemfvwwwfnnfejv{eyhivixxy{nzzmf{zixmjhxmn{{fkzzimfm{f{zfixn{kjv{g{gzhfihxivzljv{l{jvfig{wmwznyf{v{{hzvnnhmlikggmn{xyn{wyww{zhhekgnhwj{ynjgknwn{vnjejzwjgkjkhzvfwhzyzwv{w{geggekwwnj{xyyjz{vjzekfgvhzfeihzzfvfvlvynfigjenhzxmnfxw{yjig{gvjmn{fkmgxvhnykkz{fizzmfgmwwvlfinwjzzfvlvw{ennjexjmfwwggjxfzzv{{mhxyfmnhgeyjnywjfgnlxf{hmjkm{ezjxfzf{vnhjxggfm{jzlwfhv{em{xyixeejx{xhiwlfzwfmfy{v{hznwyfvfgxzjyfem{xxjjzfxjv{xee{kxhmhjz{wigv{jkzjemjeywzhkkkixfgkn{eeemznwnx{eiwwhkhxzxjeywivxlfggv{ziz{hhzvfhmzfjmhgekzx{l{{ivegeiigvygeji{evwx{xjhkhmhkwh{imlhkvlemyjjvz{zzfmhgezznyjnwzhfkevwjfihe{jgifgkeigwwgvkiyyvhevevz{zjwjhkm{fkzvjgigvyxlylxnwhxyfiwjkiizkgmygxnh{xjgvy{jfzyjx{fvjxm{kenlfivneekmwjjkjmekeijegg{vvlighxylfexwyhiewhimnnginjjgnfiejvvhvyivgejkevkgfimwggnyvlwhnlvjyfylfznfwlexv{{nn{kihzexnfwjjkzfvlmhhv{wvh{hei{hvwyn{m{xexhzfmzhimjewfwnvfx{y{igjmjx{vhx{ynwggezyf{vmhx{fmzjke{xwffeimn{nhfxnj{kgxki{gzxzwmnnlnhkkgz{jwneeigvfgxyn{z{h{zmnkkjikghvvwnlfxfixj{wvf{hyfjxzxjzyymjzvhxwwnhxhzlwfxfjeyfnykigxeviiwngvfkfihi{ww{yl{ey{evwlwnjiwhivmj{wfizy{jzxwhxhgg{ifzzvy{hiny{nvlnyixwjevemixzyezww{xwwfveezxvwjxx{{ehzxhkgjgfgjvzyzyxhn{vlz{yl{nylwhznvn{xyjzyzfeeexjk{fwnnfikwynwvngxgxml{kfijm{{whnwzzgkexzxzzyjexzvmhggnheimjvw{eem{zxjzyyyxfigzwiijzvwzv{eizeeeimn{nxw{nvnzyxnz{hm{ykiw{yfyy{gmfjiezxlnhgmeeylggxywljm{{emwjixxlkmwj{nyfhinyjk{mfvgkegjzzvgggvigvwxleefvkihx{zighxjzgegxixjgwhei{fynyyznyy{yiekgiigzv{nl{eivnym{izjv{nezggzhnfhenf{jzjizylevnhii{fv{gijeigimhzegzyfvjxvjvlkezhz{xlv{{jw{ji{jzvfkvf{gkkvlvhgggiz{{mzynymyjkjkjvvjxfynnynhnlzjxhjmfmhevhgiim{hmfkgnnfxnyvyjgvyggnjhvizzhizeiylhe{ljg{xjmgmnjgieeiz{kwlw{kmhkkghgjgv{wwivv{ynm{eenwwjnwn{y{{fmjnwnfwnjkxwjvfehifeevikjex{wnnfnwzvvnnyexfxjkz{hxfiwfhgzvx{eihexjwjz{hzjkfmmnyjjenlhzzwfixnimw{{jx{{{evgvhzn{hzhkmfkk{ez{{xfkikjzjm{e{zzym{ii{kyw{jnlmfmwzyyffv{ywnkmzwwhm{gz{gxnzlhvy{ynikhvzjynzwjmkkei{fxnwwxleeizii{vylmneixn{kfkkmn{gzgxwy{fvyvlvyvhgg{x{ehzxyjv{yfi{vyhievhn{vjhgizekhegvvhnykiyn{{ivkejigezhml{zfim{vnn{igy{hx{lxwezgiee{nevgznynnzfighk{vvlxywhhxeeynezmj{nem{nev{ewwzjvh{kexjgzy{kwnmhw{vhnywwv{hx{v{mmhz{jkzzxfwwgxmj{n{jwfimxjmhxyikwjv{{wnwizwynlmfevnneezjegyfyfzhjivfiiz{zwjvxhzyeimjkgzfyhyjekxy{fiijm{wkeiv{zjzzyhehkmnhkekzwgkfg{wwfyhxwgvzyv{{j{yvjn{gxv{jeemiggkyfyyekeekgxwvj{w{wekwjhgkm{fhxznmjhzywfmyfievngznjjeizvjjehvegwfvwjiyhmlnnmnfizh{iv{fzfkmjy{vnz{vfjmfmw{fk{m{wxjmwgzx{xhjgikezhvgivnieiiggz{nynnke{f{lzyzjyynjznm{{jwnz{ikggmjhzwwzlkgimjkmjjvy{ivwnwyvljihgjk{nigzlx{gx{m{miggxjvwwzweewlm{givn{ymyxf{mgejgixvjiemjgkx{wyezmhvlnwyh{ezxjzkemnmn{{vhxnfifxvwwhjigimlx{{k{lfijiylyjn{kgzhvlkiw{ixemeefezjfez{ivzjhvmlvhy{hvfev{kmyfnnzhemjvfenjhvnln{{vjmvwjkgmzzfknliv{khizvvyhm{g{zxngxhzwnylixhvge{nxngmy{vlmh{n{kx{jeylvnhgnwjxzfhkyjhzywzxw{fg{xjvxyz{fv{vgkeghemjfe{giefgvlfizwvljkfzkgvhx{{nkghzhg{gnjwnmjzw{lkey{wl{hji{highzfghvxhzv{wz{nfke{fgxgzjxnhznwn{vimimyhyjhmznzfylmfivjxhivjggznieeemwzv{jiv{gvywj{jwhnjzl{enn{fzjgiylm{gkgg{gzj{nkinjjgkefmmwznhkev{vwwwyjijimhnfnfhe{jjgkixn{hzlvlv{zzn{nhfm{exfgvnweiwhhxeifez{nljiem{zmnjzmhhgzjhxnwivnhfe{jnyiviivwheylv{gzzxnjyfhzeevhnykkevjimlzf{vfmkgxwmneeekvhmnxyfx{zem{izwn{znhzmwnjw{gefkvfnnxymhmwhgzwwymf{vzxfeyjxlivyhegnwy{zvjkhxkggmkgieekeg{eez{fwymfwfwljxvlyffxw{z{xw{{ixfexnmwxw{jynwfiehznwv{zzwwexvwezyykgemizggm{zlvjkmjiy{jgznhxvnekimhvgvyjhxkigi{znfnhjkmh{eig{wynzjywyy{l{w{zeggmxhjzzviefexyjz{gzlkigefzwfzxkg{nixfmwnkmvl{{{zikkmjxnh{yzlzfgvggz{jzv{mwfxgmjxkkfzhxwjjg{kwnzhheyn{znywjjxx{fxkejkfiimxwhghk{ghxnhn{{h{n{mhegenjzngx{yjxhiix{i{jwljmyjmjnnxjkk{yzzkgvyjzxy{wzhvyhmzjge{emwfgyynfxffg{i{nhefghi{fyjyhkiwfjenw{{mfyfgmezimhkixeeigvnfe{v{fixez{y{kzxkevwieevn{vn{nkmjmzvzliihzwh{y{fjmivxjgewhhzkiwn{gezxlzhylyfxwixjvixvnexylfgiez{hxkimn{fwh{jnjxlwj{wzfken{vlvfimjvfxzjzhnynhznkkxwexwfjkjgwhmlyhizkiyjxlzj{zfg{ezjizhkfvnlx{mygim{kgzwixeijxkmvnnnywivexn{{hzhfmv{kmwfkivljvhgjzzwwymfhikiizkezl{ewyxhxl{gfkxhgkimnfimynx{jiivvjegzwienwjznyikjgjkeemfjvhkyfyjkkzxfekmmnekjzimhz{xie{vz{{f{zjxjgyhhm{w{fjem{yheexfhzfky{kenyeenyezhvfkhmkkynwnke{kvjjmgzxlkgjeyjwnyyfemheefgjgexizgmyfxlvh{l{jgigx{igmgmeim{fzzlvhxl{hegfefzxn{fgkiznnjknwfvig{hzhjeylzjfen{{ywwvhzfixkkyhhxixm{wyvyvywjmfnnzh{vzvwhz{hzfxizexhximkmmyfeixxwez{jjzfkvf{jfizyizggxfvfjiem{gx{jevlmf{znykgzn{m{jjmhvkexfzzixeizlwwik{in{jxzlwynwnnxyxjgvwwfx{jmfjxmhxwggzlzyjeyymynngxmyexm{znz{{hmjvjv{{i{fywhihgyjyhhgmlgz{hhxeiezekemjmfijkkkjvem{zkefezfjgmhgiimxn{{fk{m{jjg{{zz{i{jgzmlnyx{z{myim{f{ejzyjwf{xwhmjxfgxikgkyyvngxzv{{ylfzevimynemvyiifvimiivyvwgiz{{mixwffgjmimgmgm{kvnkgjgjezjge{kvjivvfkkzy{x{wgg{lv{zhjm{iwhnhwfw{zf{kyynfkmixggyyzlzfkmzvmyjgzwkkynjxwfxy{hhegehxzhwyxjjzn{zfgmvlfzmnzwwlwwhk{mfeimkehxzl{xjzxjm{hxz{mjnhw{n{zfznje{mhkxlxyzlemggixvwfmzn{lxhwh{jfizvyfwwhkwn{zznvfjxevmlhivl{wjmkenfginniimnfknffijxzleg{nfkjewjiizh{m{lnfzy{yhzegfexwnw{fhmzfvnfmyngkzzzhyfizfvzn{vgxmlzwnljeeg{k{xvlhznffxjgyj{vn{y{w{ikxhkew{{fwfhzex{lvfevhvmjxffxmwnhzvmyjxvjn{myfmignywlix{evyyhezwynlvn{wwyevyfzximizzwhzn{jeyy{wnnixeeivzxwnwwmljg{nfkixgkkkkghxikigvlnhwjjkjgznzlzznyhxvnkgegvhkmmnmfkkvy{vzn{zimexhxhihxgmwnhivlfevwxwfzynigjiwlmjhzexzf{ihxvlhk{fv{z{wfvfnjnh{fhevfzyjzzwiizlvffvfizxmjikkeeeev{wjefgzzfkylnwwykgwlnlhkgmhifmkike{mjkkiy{gxz{kkyyvfji{e{gfezyemxfzvhkxnmnny{jekkkekzyyjyffvikyhzlkemjimfkegnfzhjmhgm{wwzxn{fifmylzw{hyh{jznjmzzywmnyngxmnz{mhzxjzmnfmjgnhywfvvl{n{{{i{{zwzhjxegx{nhvfyh{hhvixfxzwvyn{kmgijeekgiwhzyvhemeigm{keevj{l{nz{{wml{{ekwyzjwyfg{hvjzzjgxlfizlv{kezjigzyzlxh{jwnfzivzjxhnhvyzvjxfvzzzfhmv{{l{zv{hxvlwfjiixx{exz{{gvy{vwyvj{zevkkezvhzvmhzhzhhxzv{nm{gmgifzfvnymhmwxlxnegfkx{zx{wkgzvivkikgighxzx{fjk{lekjezfzlzxmfmhvjjzy{gkvfizigzv{j{ejgfgnykmhzgvwjmh{fxwywxjjk{v{jgmhgnyjzmhjijxzzzlfeyfgzzjyjvjhzxwnwv{vfikmhmnzw{m{exy{w{xm{vn{w{khiylyw{vwjhkjgznmfhvwlmjhxiin{{fwhmnwjgxgmgiyfjgyhji{lmwje{h{hezwnyyzvemzniifxml{wfkmjhk{ifkvljxfvhznf{xmynlywkehvyjhmfv{wvlxfwyx{vwkkwnmyzzigkgjex{hziziizn{kggixixizw{jkhkemnhjxfzzf{nxhhkjgvw{z{mzvy{znhivnfgvj{nynfmfefe{zexzhzwgivlheyfv{ikn{iigg{mgiexvnmnezvygx{jgzivizfxkmzlnfmfvw{zznexemfkyw{nwjzfvj{xvwnhvhfgfgjin{gvfexw{{zxyfvfywjihzyyhggmwjjgv{hk{gxjyfnfwfvl{inwkk{vvjfgxhixwhimikzxgvyhwjgzn{wfzfkmmyzhiznfxhfmnn{vjkjzjvvhxn{lhg{kvwx{jg{vzxig{kxwzxhknlkkzhkmzymwwffzjmnyfkvnmhjximylv{yl{mnygmwfei{hkmynzwwfgiv{x{ezgxwf{fnjmfhinn{{wykgkgezw{mjizkkw{kivngkevx{nljgmjwleivnmn{fyljximwyfvywwyiz{zjmkifkivivjmwlxl{l{{fiee{{mywyw{mjixvjwneg{negixjzxnzxhkgvyjwfnwemvhji{ngxvfm{{whefmge{x{fxhiiegjmkekkemkmkmwymnvnnlzxnymfiv{eee{{zhmnzjxlekzyezjiivgkxweivjjzwlz{xyvywngvm{kgylggjm{mhmivvymwylgmimzxhzvnevfmgznfxjnjiifxee{hgxhkn{jizhzvjkwjwfkexlnw{v{jjkke{j{fkkjgxfz{{{xwzlnymjyf{nnleknynnhvy{{wegnjvfwnjgfvmwxn{zxlyfeexwgkggjxfghxegwlhximnfevywzyevzw{ygm{yvfnhezfxw{xffzfmzwzywfigwhzywlhvgg{efxyjm{eg{exlzhxhhkgm{gzlxhzlkkynizzxzhy{{egeegfgivxjegnynlhv{k{fylgmnyvh{nfi{f{jvjv{jeezegwhfkvnkghenfxwzlhzezixyjjkxhhzggxlzniihkgx{nfkfeeefkekwjvyekfmmlxhz{hvjxwjv{geievf{gmjfmgeixjghkgmikwygkw{{hmjfihz{wmywl{kz{yleiynzwivvlxhfiiin{zyvw{j{fz{fgy{mlnnvffkvwyjwwkgkefk{ghenffkjg{ievixgxz{{nhgz{{izyeeyyjejkignjnwhxwfmngzmjnlgxzneejgimvnywyyfzgxww{vjxkmhifivjfkhimjyhkmwlfvywvjvnn{{leinwezvlevnynnxhfzjzxfvlvlggxfzxvyvlwf{n{yjxixfx{fmjem{ihxfiemy{ekznhmzlmwevjievnnzfm{my{{wlmymwhviifmjxyfm{hgvwvnivfxfeiknhnjfiezjexhzlggxjwfzyevnhhm{{nnzzy{hxggnjvjmnxyfzyywnnlmfwn{wgvivnyjemffi{lhkjgwfmyjezlnwvy{wiz{hnwzhhizhhzgkyyzyzleixnmjm{kihmn{{ygvm{kmwhylhivhx{fkw{yl{mimnhimfx{xgzwnyfxy{zzvggwwvnkknyzhiz{{jgjiyh{fx{hkzx{vixwl{hvhznzjzzhijz{fzlvh{vz{wjeiyligvhieizyl{hkgzngxwhfimnz{xhkghikgizikv{nfw{wfigzwjgeznfivnhfvn{{{hezjgmnj{xfe{w{{ggwhwhikxwezezzwhgvlz{ginnyfjm{xhiwfyj{j{vzleivjxwwngeggznkmyhhknfkifxexjmvlhzzxjxvwjkjm{i{w{whvznwwvniv{ngmgkznynzhkevhkevjxl{vgegzixy{ie{y{nxyvwezmfvnizimgxm{zzvyhezhhvev{lkgvfvfkim{yfmffeizemxfyhmwvfz{fxfgm{iifixyikjzyjivhkvnvhmjzxfiv{zwfz{infznhm{iwlie{v{mxwnyeznyjkmfjmeieg{fzxylzn{jhghmei{i{lkkimyjhgnlhekmfi{vhgem{fvwnweevnxjxhizxlivgmhgjkmjwngv{wzzkegxev{nzl{feifggvy{yyxfzyimvyhzzvyjhevfyweiwfwjynwwx{jekk{nfvegzvmlfinhfgjz{yyn{f{nw{w{xfkkfvjiwhvnzwkizzvnjgyf{hw{nj{y{{hefvjkzwywjenhzfeeixexwjwhmlnjw{zlm{wnhxgxgzkkhzfg{wwnnnjmggzyvwgmwnimivnhgz{wynkmkk{zivgvwwnlvngmnyjxhzjzxf{yjgggx{heje{{{gzhgmexxjzw{mwjjenhzjn{xy{iezjzvyvfjivfyyjxzfvfjknwim{igzn{{efgvy{wezx{{vgk{fnyznhzy{{khmynw{fe{xnhgijgnw{wmfixiikm{yke{fzvjz{yhxzn{nvheehgfgjexleenjfikmie{fkemf{hzjzhmnikm{hkmfmlwhxfizmjfxhzyfizievyzznfzlmnvynnxjmfzhx{ikvjwn{xzljzmhhvigvwwwzwznfkvlekzwgkiizzzhgixhzvevkkfzzzxjmnjvwhhzmnxymwnwwlhi{fnfzn{xwyevynvfznienwmh{wwnivivmnnnnj{x{lhi{fxjjkkkmnz{fxgmjezfmj{x{l{e{wfmjivl{mhvzyx{y{{nxhyjmnkgiezlivgxjg{ixh{vgk{ehzzwfeiin{{zmhwygvxlkmimjmm{wyezzwz{{g{mmnfx{{emzlezm{{{zxfzmyjkwfyymleefgnlfizfhx{hgzwl{i{hezegiimfgmhgfggzevik{iikzfgvyfwwezxwiennee{kfeywjv{kw{jmgvwyvnkgkmyjfv{m{mkex{nwvlmjmy{k{hjxmjfihkzny{vwhejkfmkmmwhghez{{f{mhzwh{izxzhn{xhmlfeigxyjihzwwyfnjvl{yjghmfzexiefmnlvygkyywnjzeghe{gylvlx{wnnnyfylmnnl{hyhkexjyyezznx{ez{{exhzvwmhyyzfkezhfe{vjgzhnj{{fzjkfvyjxhxj{yyjz{znmjkkzjmjggyyjg{hkgivfmnh{xjvvfzf{e{wkezzegjgekhxv{nn{{mlivjvjk{gizn{emzf{eivgzywwlywmjnwnffgnwyhjz{emywhnlznimeejeyjfgfzmymn{jywm{yfynxhjzxn{vmnw{exnygkvhjzmymyw{imfkxjgivfyjyfgizzfifmvnemylzfzh{y{vkmimmyhehvkefgjxxlvyhv{jhexnwjhxmlfv{xmhfmjkzxxjizhzezxn{mnjxwvhfvvlvyfvnnywxnxyikiiggzwvleiheivfvfeeikmegfvgvfkiijm{jeizzhewwwwwyzxvywjx{{jkinfwl{jzngegmjggxjvgz{fnjvw{jgkyn{z{ewlv{zjgmvhhv{xig{emn{n{z{fzxig{jeizwwl{xgihvgvwj{{vlvnxlwheghgzvkewlez{heiimeijggznwnnezzxjevfjemfn{{kmjeveevlwyhkikv{zxfvfvkemlyhiemnyhvyfzfkvynhjghmyfmnfznh{xzleziehzmjex{fyfgmnhkimnz{wjvyfzjkzj{yggeewwgmy{igyhmjwf{eemvyex{mimmh{zhgzlfekgvlw{kkxlz{hxxyzzvhz{zvkewl{vjixnfzimegmjgz{yzjhiylnfikmjxjfgnfezkmvyzxhzwwgznymwggjm{eyw{zzjyyekjifxvyxfwj{yigjiezyngihk{wge{nkkhmexhxvjjigekmgzexjmvhkkvlylgefgmn{fvwmwgeywmyji{h{kvhvjgegxjzv{jzxfevmfynnljxm{mnmyzvyfekkezwzwjiyyyjzlhefgfg{wvnxy{vkggkyl{{vl{yieeegk{mjgznnwzzy{nfmyevylfvgzkk{wwwznv{jgezny{jhm{wfmww{zfknw{m{xjkfifg{wyl{jkgfkwjjxwnixzhnhhvge{hzwzfhkjmfmkkhvfk{k{nfizjz{jmjkjv{fexny{zjgnyixegyljmv{mlnl{nynwjyjhgyyy{zjy{gzwfjmx{{z{zyfek{hggzv{jgzzjemznfk{ezvmnhgznvyjxznjzgmjiwhzfev{lxfwyhxwhigx{{i{hik{vz{mjevjgmjmneghkwfnjemwfzzhkyyzxjxmyivievnvffgfkfezwzjkk{ymjyhzf{jzyggmlzxfz{gzjm{{iemwfiewhy{vyhmzyzfvjznevnjzfyjjzmwex{zzf{ekewh{vjmkmzviifgzwfmjvvlzf{wkmjxhmnhvjylzwvfwlzxxjzjgzzhmlixn{{gvyjmmfv{zwznfv{wmfkgv{yjgxkkkev{fizxw{n{gi{gkgvlzjkeievjmjyw{j{hzw{x{liiylvlkefkkmhzwlvyxnmfznxy{nhvhixywfzh{iievnzhjkhinjyhizegw{vnnnez{fy{jxylgzhexwnymjhgvlkmmh{wv{{ekkmngkkgem{ffkxwz{gmyl{ywjhey{{zxwxlxwgghziziznwyww{hzvjkenlfx{w{xmhmhhxvngxyjvhvyizvnw{vfkkexhvfifizhwwmyzynwnyigwjw{ixjgwnxhvyivwfwjvyvhggfmz{hzyhjg{iwfnwiimwizevnfnhwwzwz{wjgveggvei{gjkzfznmfyh{k{f{ximmj{vfikijijikmjkvyimfifgvl{zjejvkkvjnjyjikhvfgeiy{xhn{{nwwik{fgxnj{gvhgzvhgkwy{vkgzlzzvynwkgmfiz{mnyjkkenfvh{wvfkifmmfjmmnxw{hnnzwy{wyhvmy{gginf{wji{{xhwwfzmnzwkkfivhx{eveeyjhmimgezjm{egexnhmfnn{mylvnxwzlyhzlhzzvivywmjhxexemzvnl{k{e{vylgzmwznw{hmxl{{xnnlfkmwimgzkimwzjxhzl{zfmfgzlwhm{jegxjx{hylixn{eeivggmnzfevkixlfmfzimjimhn{gvjgiehzzz{v{nfzvfvfw{imxnmfzhwlgegkznkgz{hegzmwkmwwemvhnyjveevfxwkg{zfiylkmyhxlz{ge{njz{kmfmlegvjz{zvml{mwnfvmlfvkiwyvyy{wwfkxjhgnligixwffenj{exwfekkzvezjzge{x{nzlhvfzegvfx{zf{ix{{jyweiml{ikeke{zzj{iyj{kz{kmgmemzj{zyfwyxjggz{vfexyjgxfehgexnjeeimy{{eiz{mnww{hmjgzfvnfmkgee{meehvmhhxemgxizji{i{vwjxyevhzvwmjhijghe{zjkfmznynxhmykm{h{vhimnyjhgnlyygmjgnwfey{nfwhemjxigmfikvwegeexf{yvjwyvjy{ezxfgzgzz{z{n{vhhkjxikzvywimv{{x{lekvnegz{hkzygixyvlvlnjixvlkefxy{jifzimkexf{mfxwlfe{w{lnhnnizmjvnxwz{gmjznnyl{zezjmie{kyyxl{mjv{jwj{injx{myex{x{xjvvhimhxgvgzzfmjivggwnhgegjmzlyhjezwhixfgiizxhhxzlnyjivyywwjxlmnem{nx{v{wjfenyxjmhexivzlfehk{ekm{kmlevjmezmhhvhzyjznfzwyxwfevnx{jigmim{wm{z{hkzxxj{nxnemizhixjjkzlfkgm{gx{m{kk{gzfwnjegm{{x{wymnmjjegeyln{vhemkgimfe{wnygvvfiimfwfmygx{vhxgzemjg{lnnn{vfiinnwlxyhzgzvnhzzhikfvxlhzxhgzzwnnznhxzlkgxjwyhgeeywfe{xyjfegkeivfzlhkjvhv{nxj{exynyxhegznwjw{{jigzwgkvjgikk{hmjjmgmzjkmyhkmxfwfjgiejzjzfegey{jgwly{vygvmfekixez{megzwggnlmhzj{j{g{gnywlexy{znjvge{hxffmzyfegmvwzjxjfz{infikyh{{zwxjgi{i{ngvvfekx{ixmlxfzzvj{vkenywy{iwfvyixw{ez{z{in{n{m{fgzwnwhgz{ez{khzivnjjvmnywhezvjzzymn{m{xkmyhwlmynyhvhgjxexfezh{yhghiiknfheizgmzhggzfxjmf{wyhiviexym{y{mfxymhmywy{mmhginn{ewyfv{kgegxfmxf{izlkgkkgehex{fkikhijeekxl{wiznlxf{yjegmwwvwhvz{mwnw{ezn{iyjixzl{knwxygvgviz{hylkgynevy{zlz{nwvnex{lw{yw{ykgivxf{fhxnfwfgm{wfgvffegxz{zhzlkkizhvkegm{gywynfkvjzyz{ywgxek{xgk{kkekmekywjmvwhivjn{yyyfeikevlyyexhkexzyhmvfwwjxizkivnfgnlvyvnkkxyzngzizvliz{gvf{{ynhmmykifmfknlwhhmgevw{n{nzv{{zfnhfxfmkmgkynkiyjhv{fjv{hzyjxvjxyjmzfixmy{z{hvymhmywyy{kmzy{e{hgmfevy{{ex{jhghvy{znegxlvwexyyienygkz{wwwwmy{hzyzhmn{gfezv{hvjynyjke{l{wvwxwvlxnmfvw{jzvfmnh{x{nhkznm{mf{i{nmn{hnjwlgg{wzxyh{nyfynikxhhiyjhzixzvy{zwizizgkjxgkynwfnnzhex{vjxxyvhik{xvyfewnwhexjigkwh{vv{{mvlmjkk{hmlvynl{lzlyj{ykeheemhmfevfznii{njkxh{{{mzvmnkemjyneg{vizxygkxwyyzfnfkkjzxhzyzxmfzhvnezezzlfx{hgggkyjwwikyfikzfnj{evjfezxmh{jmlw{zvzj{j{hmlgzix{nfmeiivyw{imyemfx{n{emfkmwjhegkfvxw{fmfxfiehvw{zxizvhyyfvzvxfhkgvvhfihx{vjmwyyffmhxig{gemnyzvyhz{emvwvnnjgxvhxhwffghihvfkzznlie{xvwkm{fyfgxemgifxyh{z{kw{zv{vwfkezjjzekz{fxylhv{lfggzkmmh{jy{jmigivmwhihkhixlm{jmx{vngxxwn{nwnjxnynyjnyhzmhwlxfwjiiw{hgevmhnjkgwj{{gmzniiv{fxz{ezkgfz{y{{kgv{jzv{ywjmnfjvhmgknhmnemgewfgeexyynhignn{n{jfe{kzznynynhzhekzz{xxhyfnjyjww{{jgxhzf{xhvnyixkevnzwwlmwmhhz{wmwwwzymnfmv{zwzjhkwlgxywyh{{fk{yhgwhzvge{jzxivgzikgi{vfxvnfmfkmhfemlezzv{{{fx{gmhxnfikkiimfvikmjgvig{ljivfvffmhxxnv{fzevfxvh{zzv{xfgfvggzxzzfkmlhekgynwhgiwwm{hmzj{e{jvfgikk{ihmegjinlnfyj{gxjhmeiem{exl{vemmyn{ggznemmnevxyhviv{w{ijikijemnxf{{kigzgxmnfmhenj{lz{mnyyjgv{ggmlhxig{wiezjfvnffx{gmhvlnh{kznzfgzgefz{nfxwlhgwwxyeem{xwjxwymnkejghxnhv{feexjvezzlzlyyjkegiimhwfnj{kfikk{izj{g{wjzmnxwgeiggzkevngmkmx{jgexkmnf{jvn{{yl{hmfegx{gzzw{xzwhi{vn{ylvjekz{jgixxhv{mn{jxjywekzwzvekfgwwywmf{mwnzhzlmfyjvw{wvlzf{wvwynjkvheifmn{xnwhhizzfk{lx{jex{vyikieeewniz{fw{mjznx{{yexwfzjzvzhzjmnievhgvezfewf{iznzhkgxlzfixxfegn{ee{v{kmy{fjmmfxl{izvv{zzyyfegz{jfgzl{i{yzh{fivmwevy{hmizjegkyfhvnlgxjehk{j{xyhkenh{ghzfiz{yhz{jkikhgnwgkex{nkihkiegv{nfzkmn{ggikkmzximexfk{hfkjmexhehgfkyn{gylwfnhgmnhn{{fjiivfzzlhzzl{vn{{wjvfmz{mlixmnfkfvmf{jmyxh{wgvkikeywfmzxkggi{{xwixvffefi{veximywjg{z{x{{jg{weviinnynfkzjwlnwzh{m{wiefvmwvl{jmhzxx{zzke{iwyjzwnzvzhyj{whm{jvwke{mywgmjxkg{wyygmz{wjvfeimyjkmwfzjemlxyfxexzhkg{x{jhgxjikvyvhzxzz{y{e{xzwv{iigegiywz{kkhix{izyw{v{hmf{vxljmjehxzyn{he{zii{miimjivmhzx{myyhxei{{jxvhivvwkmw{imzhegikfgnlnhx{hzkevnhz{lnhigmwhvfenfnyikwwkkfmfg{l{evwwffihifg{ivwzwzhji{yzyvfvfivwjvl{em{hz{ekmxfgkkkivimxnxnzfnhjmzhwjjizwxly{{wgk{ljx{zmf{zmlv{jihmmjkmgxkmjixwjmgizlxwgi{njvgv{zfmxjhkvlhvzvjg{nii{xfz{i{v{zgx{ymfzxzwxjkgfx{njmmlxyixzwfv{njenhzfkgyhizfgvjkgekyfnjvl{mhi{fieywzxnjigvh{jgejmv{zvzhhzfgyleifkie{l{wyjevvnfeeeek{ynjixgkjmkk{nzzgkw{hvywzn{j{xjvevxwx{fkwngzjvvfkikefiizjvgehivnmhig{h{hxjmnnhnfzhnlxh{wjz{gyw{i{lmnzny{yww{fijmnwxfhi{nfinhy{nhgmyjn{{lxjwn{exngiyffzzxii{vzwv{gmgm{keexfn{gzgxyjeg{nkkvyzhhvzlmh{j{xnhzlzzyfvnhghvmhmnikfzwjgxfkevx{yfmffgfmnw{l{j{v{ivlvh{ggm{kgmyweijxkefg{xxjzzgijmhzzjzjv{xygeiieijzxjzxvlvwhiwnwwgxwfim{hkmzlylfv{mhz{izhnnwlvnny{l{ekmznz{evznkifkjezn{nfkvw{{{g{igxfgyjzykm{lkk{hzjxf{ejivyvfekvynn{zezixvjgefe{xx{nfyhzyzliievyyjevwfvgghkiejm{{fx{y{ghmjgii{igznfylxhfxwyke{g{{hxikxw{fkixlzh{fjzvnmlmnywvwjmhvgzixhgyjjkzlzxnhwymygxyfxhyjiezxik{hvhyhfxy{vj{{gknjwnnfznwh{vfim{zzzzizkmwlwfynzngem{gkexgekkhijv{e{{xnwnnlm{nykehejmgmv{nh{wvhvfvnfkjmzlzx{mjxwjizzveknjnjm{{j{xxfkmwnywznjzvwnfhmjxfejveveejxwfggjmemmhyfivynezfegzfiyfzj{lxy{{{zzh{wfejvhv{xgkek{lmhggvhhvmnzfimgmvyjejznyv{kegzfijimfemfky{jxzwkgfkw{igfgnwhe{vjkexwyjxyynfw{{fzhjkhxxnmwxjeehgmlxjnneveexwggiizhivvwhk{jkkignfzfkigxynfkgzmffx{vnjjmx{whnj{kzyxlzwfxigivmfim{yjznjkmggieznmhkkieiv{fmyvlee{vxjm{hznffemhznvhhzjgvhxhiv{jxy{jemzjvlfkxymwvngmwhvnvnkkezfggkjezhzyw{kmez{xwyfeeg{wx{eemwjexhzjmnvhimzn{hexfgvhmyyjkiwwgmwjivnyekylfmevhm{inlvlevzhx{xwjifmkifijvwfwwivkezlznzjzz{eynxjnjfkgx{iwnvf{{{wgz{gnnvhiekkfvfe{yw{nyzvvwmhw{zziv{kegjxeekkzwnyzlkgxffm{jfzyjgxywjxkmzjhxki{zwjxhhgz{z{nfjz{fizn{ggvy{ikifinynfjvvnyhzw{kvjzhjezxzfnwfzivkkzzyykgkmgzwfiv{j{znj{xgxzhzl{zzfkmvl{zjmfmeinwjz{kzvmfywnhnyeizxhejgjekevhikiiwwwfgzkemwyw{l{j{zmjmnw{fi{givvjmjvnxnnhwhfzvnfezjjkyjgmgm{kfififvgzgxzw{f{{jzgvixge{xkkwlxljz{w{hynjzhzxnhe{gxfw{{jw{wnwwikmhiew{{zevnn{izzhifivfzfkeieigexnlkkwjz{wnnlwyv{jggvz{feiixyeiemzv{hwhnlyhynznjxikyjjehmwwjiyw{izvfxwj{yfm{{w{vhvjnlezkmw{{gwnjgvfjkekfzmhmhggvweenlxlw{higezjimmheinhyfhigvvn{vw{hkiiigfk{ljmzngxxwynxjgiylivy{{feviey{{{vjynvjgg{mjekmhkznvfvhnhmyem{kyh{iwl{wjghxxlgzz{fxm{ivkmzvyh{ynlekhknjjzzwkmnwkijiwjxfvhnnxwyhkinhkgz{vwevxyvnny{{fghvxyvhivyl{wnnnnwffkwjnyyjhxeew{gveiwfggxfmfv{{gzykkyjmlegv{xwwlx{{fxj{ln{{fywmn{eyyjviegikizhivnhjezv{kmyzjyygxjmjmikmwyfjkvyeikmwwyygkxfzzn{vjeikmvfw{fm{nnlxlkekgeknhzym{vwnfvlkeek{z{w{fylmjmnjmx{gxnfn{vnzlvliihgwyegzv{jzwjzemjixnywfvji{iyjxfmjjggxmnimkeik{ghkem{fvynwemwhxwegzhvhv{fxy{zyhijzgxylzlm{kgy{xwvhvfgvggyn{{ixjkwwmjm{nliz{zjvegxhzwfxfkmwv{nhfknjzn{miinwzjhe{zvnznn{nyzw{e{fekeeywyfznz{{ihmwhhkyynf{n{jmhn{yfgmfmynevgkevnn{jnw{lxhgkii{khk{kheevjzjmie{lex{y{n{kzf{fvfwfx{mymygg{ifzxfm{zlylmyvyywnjmhfgnjywfkzlkgyfmhgg{nvlvwfvmnmhnyki{j{xjizn{yyfkmgzvjmjivmfevzwxwvfvwhxvn{mvlei{hgvnwigjk{h{y{zgmez{xixkmywyfkgkigzjxwhzzwnkkjzvh{eemgmynwjeeeifiyyezhe{eggwyjxieywgmxnywzxvjzh{vgk{exjmlixfz{yhxiezwkmvnezwhw{ylhinyhgzlnfzhvwv{znev{fmjfiizgzzvhzv{{nxhfzjm{y{fvyzf{v{ifveiek{ykgnljzvy{w{e{gemnf{lhkx{y{mf{limnyfizh{lfiy{jzgv{hjzemzz{xyhegimei{fnngzfiwyevmlhxezx{yleiyw{lgemwxnyhfgfzigemz{zjhgwlfxmngkzyvjvyfewhm{kgkg{jzlzfylkeyyjgjxgiwl{n{yez{kiemynhfmfifgevnwhiji{ljifijzwjkizwfxfxezwhy{gmfmkkfiw{v{hvhkjemhjmx{evzvemxhmnvwmjy{mfnfzhkmzljvvjizkgmfy{hekiz{kikmzxnngkhvkekewwizkmje{memkmwl{gnhggmhzwevemyl{khg{nem{ym{ikfzzwhxynzlywhmzn{wnleehiekylyleggxekgkm{vh{jv{fkzn{wzl{hexzxxl{hzymh{enwgvhxwf{kxhwfnjzjzxy{z{yj{vv{izegwlxw{h{{exxjexek{vzvzhizwyzj{gxyxnmwynylzyim{vievwmhyyzjix{xzhjvnn{hikzfvywjjxxyzxxhkevnzjgkfeizjxmjjmfkjxkigejzmfjeke{hxy{niiiznhwfhxvfzl{wzljkvjgiimhviezwgmvymyggxlzzzwfex{kemyfeizxhznfvzlvlgxmjn{hgekkmfijgvf{fywm{fxiz{zx{zfyffzmfyw{fgzgkylizxnmhzyfzkkfe{wzzfmw{njx{eejgzxizfmzlexnyfzegv{vyjxfg{vhkynnwgiwlgmnwmj{mmleijiezimemvfii{hwyivgehihxylznjgyyhveizyjevh{zxn{eimzhz{fzhefvv{iixfexkkhixy{vgviezffezzkmy{v{{{hvzwyjmlvjmyiezfzynlkiwweeixivjvn{xwjzggjvevfe{f{hnhyjfi{zxykezzwjzhv{iknlzjiefk{hnhkevhjxfmylhzwwnhnlgvexxfvffkkgznnhhkgekmznkgxjjxwhxlkigx{hyl{hgvz{jegxnfexigimzyhkml{wivjivy{gnf{k{yjmjijzmfjiwykghgfeje{yivfi{nznegnlezxjxym{exkihmznmwxhgxmnjefeimfvxfw{nnw{xw{jwwxjgxwhzxkijvvjvlvhgz{yyjevjgexzvje{jhgzxfg{lkk{vfevfnjieevwhwwemjzgg{lkmwy{izwfznneiexexvhfmnhzn{zn{{gwjzhylfejexyeeevvjhxyjfvy{yf{xemzn{gixxjeghvyfm{ixmyx{z{mfwjynn{zlhmyffxmhnnfikejkyyfk{keznnnniiwnfijmekwjwwm{mhzzmhwffgvfeewnmh{gjgvnxlfmgmwwfvfzwwwnkezw{knjnf{keeevzxikkkke{hv{jg{wjx{jmlm{jkhkznim{wnnyhhgfm{zeekifekkvnvnz{nwhkzjjxfi{kwhml{ny{mygehkjixyw{wwnj{{keienhyln{{{fgnlfeynwhjevfeeizyffvhe{kig{h{nvyivwfnhvynwiinj{mkk{h{kfvemgigevyzwvjn{{yxyfeegv{mfkmjxmlig{zxjgmixizeizyjifzjgwfzz{ewnik{{{yxf{wy{hmmlywiinfivevjiyhm{{vim{enwz{vfhmnlvj{vwwxh{wmyjgvlnym{{jfx{lkivfekekjkvwjkjkjgz{jezw{gxhhxnhgx{x{gxykekknwzwxhzfjziivygxjeznfmfz{jzznygv{yekexyhzzfkxhiiv{nwixjxx{kgemzfez{n{nwjw{ig{n{{km{yzykiji{{kmfmexv{jxfmwyxyx{fihkwfiivyhxfxyhfz{vwlemji{njix{{eieizkmv{fezziv{j{gm{{zfmgzzyyfzzwljzznmfzfzyz{gzeevjie{yizzjnwxyivzhmw{vvwiemjee{{zzvf{lxhiixnkimwznmlgvxfw{{gnnnl{xmlm{zvmyzjzy{wegkexfny{jwjiviijzvwnnwngmyhm{{iwfvjnlkezwynvfzy{eegz{z{eewhvlhgzymnnnwfw{{mixki{zgxwjxjizfgjzhehznnzh{vz{gmxfx{ywhvxjvn{fxyfzmjji{em{{hzzeggezxiizhnwieiikiekjkyfvf{gwhvfw{w{yhyfxjek{h{lyf{xggz{vlfi{ghxwyhzvnyynhznwjezgxmjfvnwnymhfmfmvhemyfjew{mfhxixgegmvnvyegggxw{xhknhmfww{kjgexvnxygxzfvhixjg{nnlzh{w{ywlnl{jim{{vljeyfmnm{yjvh{vjkxwxhvw{zzh{yginhvnfmv{zl{jxwnnfkv{nyzvy{zzmwx{iezf{em{izixhvkkzz{l{giihggifvvwjenj{zmwjgmlfxizeexlzj{gexwyfvzv{mjvnfxnjizniezyzw{kvyhz{izhfigkhxmwmjimfkev{w{e{ghgieyyvwwwgxjkxjhivnfvml{lzyfv{hyhzhmljzevjv{y{ffmmf{izfgiyfivxjhx{lzyeemjxl{gkiyynjem{keiww{{y{njvj{w{yv{y{ww{ihgz{iizlxyvwvfvhzw{nxyxfigfvhm{exnmj{{yyemxhgehkyfzzfgvn{mjimhgzwwhznyxh{zfk{kxn{ejvezhgzl{wvyiehmhzjvhe{xmfgeezvwjgw{{zjenyzl{izlevivxj{wizvlivvnjxjzxjmlhzxnvwzhemjkjv{{ny{{ywgkggfemfivwwex{yiewwxn{nwwie{jw{exzlixhijvgi{yylkgnwezzhmh{{yn{z{ynfivfkevfekmkiz{gg{jwymfgvvyn{{vkkfvfiivzlzlfeyyyyvf{x{ejvmwzlyfjxwjvyyj{migmfvlw{jeixgiznm{mlzzevgegehmx{v{mjkmxf{vw{x{{lnlzynhmnmlnfeeemzngxivkem{hvemyyxnwhnw{vmjjgmhji{w{lhewly{feegfkwf{xjxjekgz{fevhimfkieivjikmmh{eikikwhfzvnfm{jvymyeevf{vjkikizhvzjjgfeyyjgjvezzn{wzvwnm{{jhiwjznzyyhjexlkmzzjmemynixzlhznnhefkjkzwwhkimwylwlfxiv{mmn{{fxjgjijv{nkixn{ymjfenj{zvyjxhvfeie{wzwvlek{zw{eevneg{yvln{gezvfxx{mfgegeiekekmeznjmhn{gixf{gegwfizfmixmlixxlxhjzezzf{mhky{jxvjkgvw{fiemnwyxlxjwnwjz{evmwiiww{njgvhhihmekzvnwixnhnwemex{hmfvjnywwkgezywgmz{gvyjfekmn{hggxyyn{{yzjhvgeznxn{jzwfmjzimfgnwemjvnfjxixkgmnywjikeikfkevxffzxnjvhv{egx{zzhnhyymn{whkyfvjvfegvfvhgixliezjvhvlfxyjnw{eiz{izyzfz{jkxwfxwy{gkiz{kk{jeg{whv{fkm{kieyhieyfn{{vzljzvyyjjmxf{yzjnlfmfzvwnjmnzhnwfvvwjifzkkyl{ygzhi{{xhemignyznkixlizjmkijim{gkkihviiyj{v{y{jgiikiiekyymnxnhmxjnnfk{lyj{nzxvjiveg{nekjgwy{kexfezf{zyhwnjvnjfgwf{ihvheigjkwyzlfxkkzz{e{e{ngvhzvywnyl{gemvh{jzlhmw{jzyy{ghzjxwnzxznzjhkigjzy{z{km{ymlfmvhmlemjzkkkmhvvhek{hjxnfzzznekfmig{fwfhmyyvljxjzkezngvn{v{jxjmigjix{yfvfjivjfg{{hehmjvie{fekyyix{nevjiwwii{zemvwevxw{kz{y{wyylhxxj{znlwfww{hv{vfhvm{hxfzfk{yx{fkmjkmnlzn{evnnjwjgxwfyyiz{hjkfeyyzwkenfkmyffkww{w{nzz{gmyeejg{kjkxwkiiigzggfzkivyivvnzv{jhxfgjgfewnvnhi{mizywyhwwyln{zzigex{jex{hnyjezyjkzwjeikvyy{zjwfgimhx{ivfgzvwh{xzhnn{giejmxl{zezzx{xjx{vmjgm{{hggknnwwvhhzekgkiggihxn{ikfvzffv{hvwjinf{m{gjvfixlzzv{yjhifxmfzwivhxzlyjnf{nylwh{{iemyvfigiezfjijzvhzvznmjyjjxhx{geex{ekzheigvzz{njx{{gz{zxwkmieggzvhgfeyjgzx{jmexnjekhizvyfgxxnkkgxvljix{hghxzfhem{jvxhzxekkigmgkwygzgiwfz{imjvv{jexnfzwjwfxjfkiizl{ihzyhhvynwj{f{wz{iijkvfm{gxyljxexnfvlmngv{zeznjm{{ehe{wwfmnwfvnigwwzvkkezz{hiw{fixj{f{wxjylznzheenhkkznvyzzfzkkgz{giivhjzmhz{heyfvlgzjifmwnfgexyjwf{xvljx{f{ynyjxnjgg{lwhzfzhvy{z{mv{izkegeeinh{ekkke{lzxwwvfie{xjifzvnjvynnf{x{zxn{{jxxfeiy{eigzexzzgeywhihezjfgm{jvjiyhyljvgvm{hzmf{fmfgeyjyhzvem{kml{yvfgxemkknfke{wnjyhfkmjjmhe{nieezfxnwhinnhgzlmnexexyjhgjgmwekvwzwnfjxfvhvjxxffg{y{kylyjfenljeixzhzwzhynvnixiin{kkw{{{kiwfjknjwyimgknniihgkmxwv{nyfi{jzfkkxf{e{kgzfvwlizvwmwzjxyfkfvnnfix{jzzhyfgex{{{wwywfkexgenwwwvnikjm{ihenl{nkmmnvfgehzvlfkimmjhk{{zjizywev{jjgyhywxy{{wyjgevexyl{zxhjx{zivvjzxyl{injjmheixyygk{enfgezvwj{hyfeevlnl{mzywjn{hk{z{k{{jizwgkimegxwemegfxgmz{wyzhmwgkvlxyfmxhwnnwfi{yhk{f{zigyfmyimivjzwhmjyhmnhxwf{{ywkm{lnnjikihz{kynhgxj{ljzhekmjg{ywnigxfwjgxww{vjx{fxyevxhiihigkhviefzhxyjfi{hwwjexfjeivwwjx{vnlhefi{kwlzlzlxhznwljikmhmkmhgzymfxyegm{hkmwjgvymy{jev{hywxhjivjhz{{myekhvgkfvnwzw{jzlimmn{jzxwn{x{ywwhefzyhwweimhzfvwgkvnjivjjxynjxynjkx{wweeekgmieznxjvneviggknjvy{mjz{mwh{hjznnfeggnwmheknhmhiv{ffzzyjzmlyfheyy{lxjjihkjvfezyyymffmjknfvy{ximxjim{kv{hvnhynexzhfvxwy{jzxy{gfgjv{xm{fg{w{kigmh{zhkggjg{kikfknnhkjmexyfnjyyhxji{izj{vez{gfv{mzh{mmwny{kjxigjieixy{nnwjiyyzhvnx{fkixy{fefzjizxegkieezhemigie{xhv{gvlyfynmhzhfmkiylnyizw{{nmy{eyhzlwlgemfxjjgkmv{ikkegkjmwjznkivnxlz{nwgmmwvhkkwy{xnjmyii{{hzieiigx{kjk{l{ieefizz{eikizggyhwh{mzlezekexwfvwvhjzkkmjyfgmmhzfxjgiwlnfzzwnixyliikmyjzjiigi{iwwfkizjz{jzzwnez{fheiggkw{kgzwzxigfvigjx{xjiexivjijizz{{vwgkkehmmfizzf{hiekgnlvnnn{m{ewlfizjjxmn{xjgex{zwhvlnjx{yl{gvjeijkvyvh{vywezmfwfhevlhkixfkxlmffxxlyh{gzvkigvwf{ixf{gkmkmy{ywzwzzmfzj{hhvmhzjnyhije{fivyhm{ixfxznkivfnnke{jmw{{yhjzxhvjxyeiigyjfijmxhvykexhjmxnfkyw{vkmhxvnml{wwnxfev{nkkvnivxh{yxyegwwfmeghemyz{eigkjifziezjvfzn{mylevjmynyn{nzv{xkg{hjg{nzwnygzfxvh{zwyx{fiiigvwjjkkmexkmjgekhzhgeg{hjxfk{jmhivixyhgveigx{jzjzzimevemv{zfgezzz{jkjghgzlgvfz{zfkemzvhxnjynvhvnfkfmxfvwignl{hvjzw{mywgzxngg{hvh{fyym{hzign{gghz{{jghvjiimjvge{jmfekywxwgiwfnyylnyyy{zzzezzvgikmhk{e{j{vmhx{ny{nxlmnnjjenfzvfmgxjgyfz{kgnyvn{eyfwhxw{kivmj{lmjzyjv{{xnjm{mzywngggi{vvl{eyfkg{lfgfgmhyf{ffkmw{fivfe{fhxemxwimeifk{nxfexmleez{vyyjgmzljk{lvjfvvwvwzhfmzyfewj{zfizvm{zxhzhxv{eimyywznzfkmigggmjnnxl{gz{vh{n{neexliznfhxznxywlgkmwkmfmez{himz{exjizxgkhvfxvym{xn{wwwvfzlgixhmnjiimjmjegikgiivy{jwf{ewnmyjvzxfeivexzlylnnixjzeim{{ekgzjkiz{zzfkez{iekjemjnhgmgefzwyhx{xekzvhzwwhxfmvfznylyfge{igkmlnfyh{x{gfmvfnhnfkkizvn{enfiewwhxynzhfey{{mwljexljzeegvm{wwfzmwzfxhvjxlzygizymffzmfimfkynyljzw{{efiiigeeeyfzwkkevn{xyjvmyzh{mfieegk{zvyvygxggjkvl{yv{iiww{gkexlmjgximxlexmy{mynn{kiyyfgjvvlzfgkgkkggizhjvgvmwnj{{zlkgx{fzez{jhkjiz{{nvyjiixjmyjmwvnnjmnzln{hkeewlxnje{lgghvnl{y{hjkvwmlevzfzn{vggyfw{fk{xzvzzz{v{yyegfzxlmjgvfifexfzymhxjxn{ezngixn{jnyn{{mzlezhk{{njyljxken{jeyfyfylywwlfzmfhkxjvhyjynmfjiiz{vvngzmhkmvn{mexvneghvvf{hvnevvnzfmhyligv{{vmlekgi{i{zvwggkiv{fmyw{hzfxjxyjkkigvmjekkihxwhke{lgehzxjei{k{injy{wh{nxygmyjmh{mexikezxnnjxj{nfgzlwhvyjxxjy{{vx{fiiixh{zgmfmnjhxznegzfhxekhvxhezwywffvfzgmgm{kw{xf{e{wznjvnyfifxjivlwfwfjvfgjmjgn{wjnjwwzzhkgzwhhmgmgkgejmzygxjk{x{gfmjejewnjikg{gnn{vkgxhwy{yzhxwfvgevnzfvnnhhegvfegi{yjmegvjxjyjhxxf{zwljvm{mfkmjgzz{ihz{hjxgkwhjmkmy{{ikkfkzjvw{xjemwzh{lnfkgexnnfkz{wn{zez{gm{{h{vnjvw{lzl{knw{gmj{e{fyl{ggmixiz{gfxjgfex{eenjn{n{yjzlemegzzgzjxylvwhkwhzlznhmke{xkkxlvwwnjkxhw{yyeeev{iyffzzn{{{jzwee{imf{zekixjmzzhznnix{iignjev{lzyez{hzfvh{jxl{{hg{ezlhevlnjfgmnhvhxyw{vww{lie{jekkk{lggylhv{eez{fjgw{{{ynylxhnnheevhmzvwy{xml{w{x{xixnhgxjmgvkmeijvzzvlznwlyywnm{mfnnjxjzjiivzf{e{zfznfyhjzmlywjenlxnkgxhzzivggfgyfgmeehzjgznggxfimjxiiizevfgnjznzxzjkexlm{mlwfxyw{{ffxhex{{ejevynlfgvjhvzwjzeifxfk{zylzwmyhxwyyfeejiexvhmnyjmlezvyzyggekzz{vwlxhfkwhnwnnezv{{iylw{n{gvxygm{jnnnwgkgmeiylkeywzlfzhxzljxn{jznhizivgx{lezzhzwjz{w{xwj{yvwhm{fwnkgnymn{xyl{hjxjvkeivhehexlzwzhgkjigznyvwhz{hnyjvjvyhwywn{lgi{mgxhkxjwnz{kmnngigvevfxmwfkynvjvnzlw{xfn{vnyjgvwjjmnyhkgkggml{jhejz{jmj{g{evlzxhxnnjk{wigivgmvfjkzhnyn{gmvwwwv{keml{wvjwlm{kizvjmkgnnxnxnfg{n{kn{n{ke{vv{hzvyjmzjiizjfxkk{eyhfmjg{gevezixvlm{mhvjm{zx{fhenffx{igizxnlwweezxmymheim{{ewwnyivz{wn{zjgfxzx{{ylywkmmlfvkmjxz{emegmwgvwjvy{hnhx{jmiifmkiigyh{izzxlhz{vmh{fii{zvjzxfmvlxhhxiihieihi{lji{nxfmhvjnhkew{wjnn{k{yvl{g{igkxnmffvhxjm{{mwnhyykim{{ymwjz{wfzhzgm{jighiz{jxnyxwfegvxhhxvl{ijgynkgzxv{xngikkmhezizvnfihigmnhkevww{zljgyngmgmyhwlkmjxvyfxezhkynmykggexwyjny{jnyn{{kgmjvxhy{zhekmyzymlfmfgivwjkky{fxnnegw{kkywfmnlyjkiyl{f{e{yvnhiyjkm{ljgylgexfzzhmjmegvjgmzygkevvnivhxnjizzfzngk{nxyxhiixn{jzfiz{{nj{iwfhvgenwnf{wznwnyjev{iwwginwfen{{zgi{jwlmhywz{y{nyjz{l{xfkfvnnm{wwjewhw{ezn{gvzxyyyjvfmlvjznyyxlekwnjewyfkiiivmfny{lw{zhgz{hxhiez{{j{nx{ixxn{jkimfkg{v{nfkmyxnkkjgzxywnwmngkeezj{gfgz{ig{ey{{lkg{ix{zzjxwygkzyzfemzlig{{xlivwlemfkeizfywgk{nnymhev{keexfevvlwjyjeghevlxhjeggjxnnjmhekgmlgmjiyfkmjmhx{jnnjzjxvngmexizhvmh{nnj{kfvevyfxneezyxwizmhimjinjkeggzlkmxnzlzzyfevfkvfgggefvzvigvwyyzjvfgmeezjeigmfvgv{ynhim{egi{nhizvzy{ngk{gfizxgi{{fmyjmhfvwfji{zxyxwnjzxjvz{njvymhyywngijzfxnl{kgxixyykmhmjz{jmwyhvjfkkmvyyln{yweknhvnjxnjvygzjxgkvwhvxyxhhxynikjgem{xnjyw{yhiiky{nl{izjxfnj{jhexn{k{g{g{y{g{hy{vyhvxwmnwy{fzfegwj{levzfwfwheixn{mhg{f{jiehihkynwyegikhzfvimvnfvynkgyyzxixv{gvnwxlhike{ivygizlyjwfkmfvz{jz{hkegkkkkmzz{gnl{mxjznnlfvvhwhzvzl{{gxxfgv{nxheivy{nnwfmwhzlekzfjgxnnhhgivvjjijk{hfizfxnemvlgz{vzjfmyh{l{meehzx{yhhxyyvjxnjxgmjgmfezz{mnjx{hex{zgzjzheixemmhfkz{vhzhgkmfjvfgz{feywfkgvgzivx{ivnhixnnnjznjevjgmmnkgvfig{eizxfzxhkemeigghxvnjkvjmfmw{fimfm{vjkmfwhznyfex{zywjihg{xxwwn{nek{z{yimz{mynlm{ji{y{fzwyhxj{wzwfmzy{efzmnixzxjexfn{jegzy{ivmwkijvznjmekwfvl{e{hjvhihigzxyxyzlvhixgefmhxv{jeiev{yhnwww{vhkylvnnlezfmfk{ygzggxfixw{ivfxgmhvmyggzwnhgizzmjmfwnkmevxjznxhvwjivlixezzlgzyj{jmfznznwyivxnfenln{nhnyggixxf{lfgkkjghknwvfwwnw{njzwfhxfkylhxkegkzlynxhjx{wekigeknfzxzhzhkiev{jwyhihkgxfe{izfnjmh{xkmivmljgjxemegiihzegvwfk{wny{{vlnhevmfzjiv{ejvn{{imnznyy{evfzzikw{jkzw{wzvzvn{{gnffgfennegywhmgzjvmljkgegihmylwwhiznjiynnl{vy{ixgvfzmykizfmjgm{zivmwjziggegzxyzfznhveinwgvyyyffihm{wwnvlfzvhjkiezlhiyjfmhiimnfz{mh{xfgxjgzexwfhk{yyfwniimwgvvwexnfvhmy{ymljivwjifxik{zvf{fyfgeekzn{iwjkgwyjewh{hizeinyhkzfkkv{ywynynzynygivw{z{fmweiyyfivw{vkmmwy{vynwxhggjejvemnhfmxlxnznz{kkwlfemwxfxwggznhevnhvzlmhjgvjem{megxlx{kkwhv{{yzfhi{{z{egfmzxywzwnfmyzyjmegeefvxligjzwwmfiezjxnjxyyjzvfjv{e{lggiikevjxhizvwhimnzfx{nlylw{{khkhxzz{h{{jkvywnmlegzvggfkjzx{jvjijg{{mfn{xlyhyfgi{whewjkk{f{fyjjmynxywn{lnyn{zxhgfimjhznjjkyhgkmlnwhg{hzjfkfiemzyeexw{x{vhzmfexyffmx{ivjzimgxzlyhekvjmhgkxyv{w{nyxwfgzlzyz{fvezynhkegevvyfvixfgjz{{x{jmjx{w{imn{ljxwlvlwfhefzvhz{fiikkgxjxyvw{{{wvnmhzhigfzjmhxvwnfjmzymfvnwhvwv{zxfgzfvlxwz{jifvhgjgegmfixw{njgxzwmfzwnnimwhwwzvix{jxhmf{lhegzwwek{{mwmhjzyf{g{znh{evh{wfgylwlhmiikkfzmwhk{lgxzwy{jzzwvfn{{lvleggvjmx{ezhvxneefxywvljxnhjgxngzvjhxivkknfzl{zzxkenfkiylxlkmjmvfnl{yjxje{gxfxhixhkgivyeev{xnylnlznkgjzizwhhmhvvnkeimhigmyl{nzhzwkixfvnkinyxyhimwemzlgvvwhgvjjiekyyhzwffvxhjvhzezjevfgmix{fvhm{y{xjvfkexffzv{{yxfzvyhvlexmhkigifmyfhvgk{mnhhvjxkkikzvwjmlzyfzggxjjkzvivkijiivfi{kvfjexywjwhmfv{xffmfghvxyvnikfghgjmzjx{fefggevfvfjmmhmyx{zfn{nn{w{zwfhxwjmhmjw{mnevhijz{hfvzxixmlfewneefizxjgfmyfkijkzlfe{zez{kxhfihzzyhvvjvwhmjm{nixmfmywjmjmnxjggexfzfm{megvfkewlgxxn{jzfnjgxy{vf{zgg{hiknlwjhvhxkkyh{vyyzny{hm{yzyxfnnezhzgzjz{w{zwjzyfe{gnl{hjvnfvyemzxfgx{jx{lkghxzyik{v{jgxkigiivighvmwmj{fyhyfhznyei{hvwzjiigkexvfjk{x{n{kfgfmvnjgnfy{igfegivhmj{{{njv{eyyvwwjvlwf{kvhyfgzwwixjvylkgkk{jnhnfnhzlvfwjvlfzkg{wkifg{znjjv{ixjmf{gwjig{hekimz{{gkmhkvhfkzvfkeifzw{nyhkigfe{lmhhzwljiizfmkmyfv{egyyvf{ekkeewhgzz{fvhmyly{emevvneez{nygvnjemwym{gikk{xjvegggvhvlzwywgkhijx{{vhkmwj{xfimfgxheixhzwyez{hywizvwwyfmigx{zxx{hgjzjihmwyzynhvj{nnh{hwyjznf{hmjkihvvjy{xwm{ikxjji{ivwjxmnyjji{zz{vnnw{gfvzz{j{zhxxfx{zjkkivivegeeexkgigekeix{{mnhmwnjjzvfhzjk{yxhzhzfjinf{{fxevfzhm{jxjggxw{kmhez{kgkgifvyfgg{hkkfxfvgmmjzngm{ffehz{fkmkmyfv{xfgmxlvjmhvneexhgvxfkg{wkigg{mvhex{g{y{gfijgyl{ngx{yizzlgmzjizn{mngivykm{zeewly{jmjzyfzvggfvegnlzy{gjemhikzzylkgzhw{ievjnfyfzwzjhkgi{kn{n{nwhxnjjzjezwvlgixhjmmn{vjkxlwfhgkmn{{zwnzjexvl{hgeimixylimvwfgzy{zjiyfv{whjzeix{emmfw{hgvh{zgmfvmnvnwjynvnezyl{vylfknlhi{gxlznjmnn{kgxzhggkivjgzv{{wivjxhzy{fkimek{y{hznzhwyeegm{ewhjezhjmigkgxhwfynkknwxwwfzzhk{lmjmwnyjveznlvfivxhfxeigi{lvykinfzxyjmn{{ikjxggkikifvggnyxfwn{wfzw{{j{gjeeiz{im{l{kzyezvnnhevvfjikmvlz{yhm{{kjk{jnjjz{ykmjmfihg{hie{{vjemgx{{z{jm{i{xmjkkgmvwixzlvl{jn{ywvwvl{ghmzwxjw{ynww{lnh{kee{{kijmmnjm{y{jn{wngkzl{{heem{lixgkfvzhfgzvgg{m{v{nvywjxnjxxleejmvhkmevjkvymlix{xgifi{njvyjig{whvvy{{yhhi{knyhghggghmfev{immfzwekgiiz{nixzhkijznfv{xlznjmgi{wyhzwjenjjkheylkmmhfi{nixjmx{iiz{eehzmwezzwhxxlfxzzhkfewh{ynnhvxwjezlyfjeeinf{xjxexjgyly{gxfghkvlfe{gkigefg{jfzzxxjwfggizn{hv{wzn{{imzyevkg{yzngkyfz{vnegeemfjghkzf{eeeml{wixxhgvxfx{ieyf{ffgmnmn{yywyw{{z{gx{m{lzyvfgzjixwfzgimhzjgikigmfiggjxkiwfvhxjfvjk{geejkgznjylwj{ymhfkgzfxievh{ijk{ewfeizh{nnnwjem{i{lmyixjzvfwnxhywjiezzh{{vyeifxek{hwjge{hzzzzvwn{ighzhznwzwhzemxjkmiizlwlnfim{mnjmfzwevm{{fzfmjzv{f{mjzzlhxkmfmiz{zyh{gxlzvhvynivkmfxggxl{z{l{lmfnh{{hvegexkgzx{n{hznzhfk{mww{xkgxwfzhzigekevfeiekg{fhehimfhz{xvwwfzhwnixiifmjgmyhiwjemvl{lw{myxneevwivyyizfkimxhnyxlfijxwjkgzl{{jghemwkkvy{yvwhzikigzjgz{y{fvfxfvfxhemxj{ivwvnzjjeyhzfwfvfylvj{eikimhvfxz{kkw{{njmegjgigixyhizkifvimzzwlivmnvly{mngmnnvfwfnwm{xhvl{wzfwjgiekheek{wmymheemyzh{l{iwlnfevfmnywlylyyzffewhhkggmlyjkkjgyfizy{gewnmlyfy{m{vnfihmxyfezyvjxnnjyjzwmwvh{lggkk{ygmjeikmjmfiivwxjekvlzf{zn{zhivgvjmgigz{e{wvwegzwkmgzkmhx{hmwzh{{he{zivyliehikejxz{hvjkjzjm{{wfmfeifkegjezl{fvnn{nwxwjefmzvzffvfejveznnyfxykeevwjjvei{ezzezw{kgeife{{jzfvfv{{keegjz{mvlhgxhv{nnwnhzzhmjjkmjvhkg{{wfkmgvxfyfeggx{g{njvkeezmlimnjfxhvwhjivjizyw{w{lzygknjzjfkyfigv{wnzwwlzyegigzwwwizvf{yhv{fzziewhxffxixixxj{fwhzwikywy{mwwhgmwymjxfvn{mn{{nfgemnhhz{ngxv{gzjkynkeikxnwyvhfkvhxnjmign{{mfghvzjwfhgy{z{yjvh{wnl{kmfemeezf{{kkevvnjxgkwfmfwnikgezv{fwhkmjk{vzj{gz{ex{eekgegmkgvjznyleezxv{gxjgkmmhzngkmym{ei{niezlie{nkmxhfiwhfzekgg{weijxynivvwhmeegi{ixfzykivjvwvwemkgnykiy{ggfmnfnjhi{x{{ezjxkkkgfzfzyfnykiegz{fkgmgehgwhyw{x{nhimhfvn{fk{vfmvy{wfk{nizxhnlnhfifvvjmfkknlwlgggx{xjixhxjxhzwxjv{kizx{nizwhfgevizwfizwjxnjejx{nhemhzyhevl{kzjge{evymh{lgzfegeznmlxlkkvnwymhvwy{emexn{vj{mvww{xjjxhvmlfiwnnlyjhemhhkzwn{vj{ez{fkzxhm{ijifzvjvwhmznxjjxgeivmhhiyfgvemvyfg{nzzzhnwhijzzv{hjg{{ynwhnnx{hgjzzjxyjmxyynxj{kfejkmnxf{lm{mh{gxhkk{jemnjiv{x{feivh{lxl{ewjxlhiyyfejvegfex{{vmj{l{lxjynyjev{vzvjvfvhzekjkwwhzfmjzywfkylfzgmnlvf{wzjvfyfzlvh{fyhvfww{ffziz{wgzhz{jxwjzemynn{zyy{zjx{zj{jimhzvlgx{k{w{x{zzwwlmfzvhi{ynhgxgejxieigxlznjkzwvy{keknyfefgvfz{kkywee{vxjigy{{vylznkeiz{vwlzvmfvyylfeyfvjizwfgxxljvznfkmhggnlimkgyhzyje{{zvzwggienfzvxwwhywggikizyjmjwfezjez{ywxyx{{wegw{imzzikvljvn{fmmfznzvy{ywwy{hizznw{xyhzzzmlxyzlxligjzgiimekfmiihgnjmjizxfixfzxjiv{iwwegik{ejznfmniixwfihvmwn{fk{{zwy{jiigvyylv{{fwjfxkikmml{mzwfihkmyekmwywevgmfkfkzjzxyfwjmhyw{l{yv{feml{n{ikigiy{yj{fwlyn{zfkwfjgfgfv{ynwwwixnh{iyl{zkmxwzwnwigwjjevhzy{xxhyhwy{kjkjmnnkkyyvj{xmw{g{lkixjxjjvggzfgk{kvnvfhvylz{fmy{zwnwyyywjekkzxhmzlx{{eexjmvhvym{{xwl{knyzjkiemx{{fjezvz{{jnleinjjzeim{{ewwzlzjz{wnwyyfgiixkmzxhzjiwyizgg{zmwywxjyhgvv{fefxnwhi{ygijgfi{zmhgvjghexnzxyf{{jinnyljiezz{zj{hkmvhvfhm{xzwfe{{x{zximhv{gw{jkgekewjnjnnjigxyh{gizxyixznmwnn{{ekhvhzzy{njxzyjgvhfmxy{zxnzhmjvnvjvlnf{{{gzjzlzwny{yhvnnjzvwnnxfmnwjyf{vyjjmggyjmh{wjejvjmheke{jfxxj{efmjixngmimezeizjem{jzxzjxh{wemjevnvwmfzjiefmjxjzvyfzhvxwmnjiik{xylvfxjekyjjmzlw{{wzjvfwhmlwnjvwyjknjnjkijxw{zjnfjzmjfxhegxjzgiznjex{zyzhfejinjxhmfzz{jnwmhevn{mwmyzhzjkiznzjhxigvlixvnfxiix{ikxjggkghkkmhvgkhx{mx{y{vfeejgy{{iwwgin{vfekyfemxhimjxjxgzjxzynlxfmwhkvwevggywznexix{{zygkimxnvhyhzxzykemnev{jxw{ejzzzjzyjvhivnywfemnjyw{zkegiylwhhmhzkk{wezfzhm{vyy{ym{jen{zzyjmjeemlzjfxeejihzxfjk{ikiy{mnjifkfimjeimfwwwlhvizex{jzfvngivlkifkjkjejm{xixnhie{fem{f{efkikjmkmvh{lznmfmlixiznjwh{wekxhkgvneggx{jheikhvzv{{wlgxgigxfm{{kmvnjmjehvhxwfgkyjxwexekynivmyggxfjmmfzzz{emjzjx{mjxjxhi{j{kmhnjwyzhgixfgijzmlggwyw{{evneinywnezkehgiiigimevwnfvn{yjwjnjxfxyfzgv{ewyig{eigjgwjfximyyeeeehzyh{{ixekjgzwimmnfejixhjgzlvyvnyygvivfx{gzxfehxhzjifmm{zwm{z{{liez{mnxwge{gnynj{gkmxyezxywfyhnw{zhkwykkgevfwlkg{fzhxn{hfefenjgm{gzfggwyxjezikii{weennexwl{yfieezxfmjmwwgekmgeixezynfejmjxge{xvffz{fmymlfgxhznxyfvyyfzynhejmkmwjevkgxlxfnhz{zynngenyxlezvlmy{e{vjkgvmnggwfwlvw{i{vvhfkvwfkjvji{fnhzxek{hfxyjwwfixwwjylvf{yyhkkkmyweimhjvxj{gvfhvwjivfgkevlynvnieeivjekzfjefgjv{zge{ljkm{ixhihvevmwjgw{{hggv{gz{zwwexvyzyieynje{nke{wexzyhm{vynzjfmm{evzwyjxw{f{xjkvlvjzl{jzzhk{vw{he{y{limkmhx{yfgxnfkhv{lhiyfvn{lyjwjimxywjhghexyeeiekgyh{zixyjgxzyfehgwhxykgekegwhnheixngi{kxlzygznlfkwl{vvwnnwwfmkijvy{nhgm{jwwgzmlfkgxkg{yzjvwhgmhyjvw{wwfhkfgzvwyjgyhiezw{zv{x{ywnjezy{z{{nki{wmnkmwljxfvmwnj{hjegxfmn{vlvjxlxhgzvjny{{gkggjiyyvnfgxjxym{gkikz{xjjg{zhexl{vyhxhzjxhm{gzxjeeegzz{yyfkeigjikmzlz{mhiem{x{fekijemfn{hveg{ewjvww{xnizxwzyevzjvn{ynfz{gz{nhkxfevfzkmynywikznexfihghiji{vikexfimyzz{nmnnyfxgxggjgvnmjzfz{{l{iemkimynnegyfn{ji{g{e{h{ghxnnekggeijiem{fxnjxyfkemfgigziinljgkgkkfziimnylhvheemnhm{evvlekynivwfzziew{{xnnxn{z{nhmfmfmzjwleenjmjivfiezemiiigvykkyy{g{ykgfiw{zyezkefvx{vyxljimygkvwfxxw{yvhiejiwwzxgzzvgmgekewwexhzxfjmfizv{hnlzwwh{iwjhezlnnyyegfkwhw{eghvhxhvnjnw{ehmjgxlnlii{gzz{vgezvegvyxfim{mjxmwxj{ggkemwfvyjiekfmnygeylvlzjkizfzlv{hmhkkk{nzvkezlfieev{kgikwfei{k{vhmn{ikxffiyhxw{vgm{neeexyjhxx{{ivwyhzykgwhznxygziviiyly{wlheyhemeim{n{vfhgjxyynwyffxmjm{zym{{ngzhv{jyfy{{fn{zxwhzjnfyywwxj{fxlkinjgkzwjgizv{xjmjhgjejmhizxikivzneixf{fjmmlwyfkxywfvhmlxjjxexxhzvgxfgfgwnwhfvzljmmj{nv{jiwhzneennyf{wjzzz{fzljg{vizylwl{vxhwlxhjmevemzyie{gjzev{fmn{zzvevkgnjwlxnw{zwigjkfmfiem{jnfegxjnhfeynvfgezlmhmyjvixig{evfhxjvywkiixyhwnekvlm{gefv{hhekg{{vjkezhzhgixhnjiimy{ivj{wemgikiegwwhikekewhhxxwzjkgyj{meew{yyiimlzfhkfmfvzw{gxjfzv{zyvfxwzvkevjz{zjyheijinjy{evynfiz{vliijzfkmnmwvjiv{y{zvfy{{lkkfkxn{f{lkiikyy{ehx{nnfekx{zfz{mjxnekyhiv{ezlxw{hvfjevjyfyfjximmlhigky{eehigm{iiexnw{mfvhzhgivj{mzwvf{kfxexw{w{{xmyz{kkw{zffvwlxhz{xygkwhkewf{jgzjmmj{lzzje{yjinhvwzljk{vvfevgkn{jmhxjmzvz{ivwjnnxyfvzjhxiz{xjmivzwki{fzykgmf{{kmznhekigivlywwhgzizivkg{vhmienh{jgvigzjnngmkmjeyfw{mjvl{ygghmwn{nvj{{nygx{gjk{ywfgkn{{evyyffemnjkwhywxfvwimkgmwvhkgnjv{gxig{fvfxwnlhxzjeegz{nnf{ynnx{yynhxwzlkmhm{hvjigiiexeegiwjfm{egmjvynmfekzhyfjxgi{wxj{mje{vwj{{wlix{ikgkihvnhynylwynnnfmlizxnywhefzkigxwww{vhmnvyyf{fiiylgmxjyweezjyjivvyevekvlizfmhkfzzxev{vfm{igvmjnl{yikgmwnz{jkixzhnyivvjxywlezyfxlgmxy{fiehxyhjzgm{ghmjijefziizlxlgxxlzwjxnhezwfmnmlzwezhg{e{zyywf{y{{hefzvn{lw{ggvnxlvwixy{hxvy{xixwlkgkkwwxhyjvwikfzfxmhmwgzizzz{kvyvjhigiei{{jx{zizxh{egizwwjjmfi{wzfivxyv{jkwhz{{iwnmleevfwjhxmyyykgfexyyyzwhgnnevjgznhvjzezhkml{vhkxj{e{jvyhxfmwyynhekg{z{lgejgxhyffkeihvvlxlmn{kfmyy{lfmgkeinfhikm{g{zzwylivzngzzfmwiixhxyfmm{ynekzy{yevylev{wmngejxjxmjxykevniizf{yeehxggjgnwvfvjx{kmxhvngkmngigxnnylnhjzvykefvyljkgizhixkgnyjz{m{{geyhfgkkvwgzx{hg{lhxzyzl{ykmikynzwzj{wmh{fwlegnwexxwmnjxwlnyw{xnfmv{hvvnxlievnxfggkmxnvffgjm{{ggvjyyzvwlfxnliihz{kjghexhmww{fveegkzy{kwywwhghk{nexivvjzx{zznkm{zmhzyvl{jix{heivhmhwhji{vxfy{xjhzfxikzyzn{knj{gm{zngxiximjexwznvjznv{zvjg{vzymjzyizxf{{z{ynnlwl{xfvyygex{finfnjhiixvlzvjxevhxzvmnwyjkvwxhkmeijkgexnek{vkihvwlnfnhxwwwnygggzkiiifmxhgzfiy{gem{myhm{zv{wyhz{infevjiyjimnwvl{hmlvwxfizgim{fxexyyyhegmfzymh{yywfxgkxlmnwfwnyfv{nnyfyj{kynizyyizhxv{mhnlxfhenjfiikjgy{xjhejxfzvfnfevgzki{zfmxyfmnywnixxlhzfmevemkieinwje{emhjgkmkiwffemfjv{nzlvfzjyfgmekwlfxww{khvgvnwnyzjkiemzfnhgevhek{{ezxffgnneivlggvneejehenyw{himhxy{jgmjxxhvf{lzln{wymlimxfkm{meeyl{xjkjxyffxxn{ey{imzznnvyzyn{{hfxnnhz{gmlhgixwhkixw{fiiem{{ywheylyfzjhxkmnfxnfxy{z{n{ynvyyfzjfejv{jvyylhmxyzvgziiemwfzvwnvhkievegv{yhik{xgzjzgzywxnmjhz{{ynyyegkgizw{wjmyjexl{ex{yyhihizlzxwy{exj{wkiixvyixkewlyjwjzhyfeiwwim{mivwwmhyyywvwyw{ngewwvlzhyyynzffxggfefiezemken{njn{gg{gjgvhylhmvnyw{hikevjxjmhxfiwwfxyjfmxwxlvnzyywyn{yyl{kmlezzvfk{vzlx{m{{hmnhzn{{fnhevgewwvyvhievyyy{h{hvfekzxzw{zwnixkgfi{ikew{yhfmkmyyw{ikjxnfhemlfgfzwyv{nh{mwngefvvfvjmfeejgmhjzzyzxfmggzyxjkiml{hjizjkgjifkm{imwf{yimxl{xem{m{gvnxj{vnyx{hgynvwyhhzwjnfzx{zzlgxyyvlnh{nmn{mzhzwjgyywhfzyfjmje{mkivnywnh{m{fnj{iig{ynyny{jv{finlv{{njkhkvy{xfizw{jwjfzfvy{jgfzik{ywhgizwfmezfknwzjmjvwighz{lxnhggehmxhmwzygvkemy{kiefzix{n{jny{emnezki{mfzn{ikywzhgghxkkwwxlv{z{wffgv{vyezxywhzxxyvlz{mniixhhz{vnywjvlmljzhvxhnnm{gmwjnlixmj{gm{nnn{njgzjzyjexvlfg{znhznylyjv{xwjk{x{{ek{vfe{nxngeiew{xy{{xhwlnyw{ex{ixyynvlzl{hmlzn{xhxekgmfvegnwjkylxnmf{vevgmvnjez{fehz{xzjzjhzmwgigznfzyvwzvfgnjkenjhgzjiimwnyigjvwf{i{jegwn{xynigzh{ljgfzkmkinjjxnwgxnyxwfehznln{nnnhnyzfvhikjiiemjjm{ifgv{{ggkigyhfg{wkmvjvhfkkmhiw{z{ezylfx{{zjjzgkgxw{ikz{yjzln{zfvjjk{hwlezig{yhzmhzjynm{jz{kvjwyizimexnnn{w{zw{nvl{vvf{hv{wwnjkgexwynfwwwhz{ywfivnm{x{vf{nekjmxyzlww{yvhnyjkxjgihvegfmz{hk{yikmh{nfk{lmf{{jznjzyvfnfezxnjkgxnfznxnwhzximiemnwnkmvnfegzv{xyn{{efgn{wyiximhkzlyhwh{fevhizvzvvhfgw{nhmfexylnwfx{ejxvhvnzxfvvhimhizyfx{ynnmhyn{izhmwxhwhkefgzvznnhyhizzh{x{z{zie{jmwnnxfixyneg{ywyfzkiwj{iwyjxn{xj{mgmievlhz{{xfxn{lixnhwfkeieyfnhei{l{y{j{kyhn{wwfivwwhiiylixmjxlmngvnyfegijvhv{izjhgmligjv{jikvlvnxykimwfzkmgvxlxjy{kgkgeez{{g{g{y{gwjixjmzxzwhxekyjjiimnygxgkfk{hezkewjfev{eenhmyznz{mjxhexkev{eezfge{x{nnlkigvmfkix{mnfehgvnnjgmfgmjekgkxnevfvvnfmzzii{exjjkji{my{kimjhgzfzjixkkyfv{mfjehexffvzhevhmmlikvnjgjx{e{khkjxmf{jww{mvfjkii{zwjwnezjzjg{xwlvyjzxlfvfxjg{kgxmhhekkjejxiv{k{lxwekzzmnnjzwjvixvnn{{gzhmfzwheie{w{ykmfgexgehxjg{j{ihinlfmvhxyxw{hfmeefkhvfkjkw{hefg{xwjxjwlz{vwnwevznfmyn{jii{wkkgkikjvhkmyvjmnivggmj{lmhfvnyx{yjxnhifkyyienf{{xf{nzh{xyjfxfifeexwfy{hizweviizlmhgmjegzxw{yjizzkizh{vzwvj{lfkxj{fm{gkkihmkikkmjywkk{hevznnngi{nzzjz{wkk{zvnheexkk{i{nzwkggixhjm{zzhkivwggiggi{e{mfmezjveigkw{jmvlmjvjm{iejg{vkkxhwnvnn{xnhghixjyfz{{hevjzjgny{eyj{xhxfmgmikn{mlmfz{znvwxwyy{nmfx{exiiznjmgiyyxfnlm{xjmnjg{fzxnnvynfyyjxgvhmmwgzyhyy{ymnfkigwf{ihmiivfexmhezml{ixjgv{hxf{mjmkg{kxlxnv{wnnhxnezgiv{zhhk{wgihgwwxjjxwniijxvygxzwz{ynfvwjnnyf{gevvw{nw{{jgkkkvwhgzwez{xixvnnjz{xjw{gvxjyj{n{mnwjmvfnwkgzyvf{vvnjxzfiijghgxlgezjx{jekmkghgwwxykigizhmwgxezkijgezxhxfvneexlmnnjggzvxljz{kwwjm{iwhjxwjjkw{zwywiikmzwfzegkmvwhehkjiynw{hkwyjkzlyjiixh{efxgeyngegxhmxnkgeezlzheimlhvwhez{fyjhv{k{fvhvwvynhvhjky{hg{gvyvyggfmxnexei{ynyfkzjxl{mee{vyjzhwhhe{veejmee{ffmiin{{hgvzhjgmyimnljzmwz{{xkg{zhmylw{zxnwhgxnxnnf{jz{nneizngiimnykeevem{fvjzzhmhvvjwnm{kemhmfiinwwwkewwkmyykizzzffejgegvjjv{khgxwggyynhzh{fm{fxn{nyemvnexkkwyxfxjzyyfzjgkzfvwezmjxww{zljijxjizwixiejm{yzywynjzjmjzyzv{{ji{{jv{vyymyznzwynn{jzhzm{{kyyixmygg{zgxmfegnfyfhkexyyml{fw{jmiijew{xnkkjkfiwnivzweix{zh{nmyigzjevyjfejxyynwyjnhnwy{emvnmnnyixhkjmixhmevx{fg{vikxfnlfkekzxzzezzwem{yyfjkggfzkghzjmmfnhjivwx{jmgiynyfev{gjvkm{hkekmhgzn{gyn{gnhmf{fx{hzeikkxjvwhzjkkejxgxvf{iighgmy{nzl{wz{vw{e{lexn{mwfkezwngm{jyh{wmwgixl{vivnwzviikiwjxfn{gzgxznwf{nznji{m{w{ikghkynfz{njiyyzh{v{fekkehvzjkmzw{lkg{myln{mywfmnzwznyy{nz{zwjgvymlkievix{y{wiznfemw{izvjw{wyxyjewhjey{{mjkvnzvexvfkmginyiivhhkm{{zizxl{nggzn{kfmgzvnzfzhemvymnkkegwlm{mhkijgxyhkyj{yhzgmxy{lmfhkkkvlkewynfnhn{xl{mgieez{vyzw{gz{giv{xf{xyjhkxyy{w{jiikgkxfnfvfwjwnxykkzy{ihiginjhmw{kgiehvzzm{{zjiw{jkwf{mvlzhnnfgzyegkmzvxywnxwhgzhmfzwhey{{mzhjigiwygkynhzeikmnw{fw{hgnfxyvf{knw{livn{gg{j{evynjfkjefgfiegzv{enwgkywfgy{jkfx{nhewlvwvlvjfmgmz{mwgkjzmlhevwnyhxwwnjhkexmw{{kiz{ylyfm{{h{vnfzfmlzxnnfizlmynhnfw{zh{zxwwwylvl{izhnfjzignnhxvyzjwfhv{xwjfvywieiejg{j{xwjfzxykgjehkmjgejifezwjeiizhzxwyznnyylfvyhmlzwemmfeifv{ezzkmkmnljkxhxw{zwn{jjmkg{hznx{gzkmz{x{jew{zlnjywzhzwylmhyynjmww{wjml{nwwik{mn{vw{eivzyznhkhxfg{n{gfmexznjmheeihmnlfvmn{lnhezyyy{zljkegjizznyjgnwgxzhvygx{wmn{vhmexjewfwhxywl{veigzhiexvweg{kvhnjxfzlwf{xjxhzyyfghxem{ygmivnnzvzz{nw{jggmwhfifk{wwhvykmwffekizzjveg{w{{jgeife{jivhgzfzxwn{lixwykexlgzzjzzvnjxvyvfzl{njifg{jizxyivvl{iznw{ikgknyfigijmxwwyfeikfvggmhxjjv{w{vhehzy{ggzzyy{{hmwfmwzfnnwfggjvekfx{kezzfzhemiemw{vyhw{{jv{mfgx{lgveenjhv{hjx{jy{emjgzlkewhikzjwnixmlhzvwggxnxyylwhwn{y{{w{jmnyy{gzfgekemem{nyjgkkeigevjkhxzxjiwhy{zn{vfxmwmhnwhkievygmyhfvkmhimhyhjzxnivjmy{zxvwmw{gxwjezvzwemjzhkvhiziivlexhvjm{vnfnnzyzxezmhfgeeyhjv{{eevfjvgigkigekzjfmjvxyzvhez{vnkmevkikgyjeghe{gjgfewyeemhggnnfimh{{jgzhjzzjnl{gzlxhvfhzgvkez{xhnlzyjvznizeveiekjmnfmwjgyjki{yxfix{njm{x{wegwnjvmnw{xyvjgizyyfkihmxjgv{xwwxfzlwwkkwfgzfkzwx{nliv{vhvjiy{nhmj{kgi{lfexhjmigwlje{ewwzjhvzxxjfkfifiznjxzxywgevh{fvfiejxzvhiemwj{xkiwyywml{{gijiznmjxwy{iemjwyfmxhny{yxjnw{{hkjgji{wnfexmjmn{vfizyim{nnlekeemwvn{e{jkkvjynx{wjxfylvlhxigmwkeznnwzhxn{ny{zwywwjv{hvwfv{znmhjeynhvjzmh{mjmznfzxf{h{wmlemhvxfjmeenlixfigeyynnnffezwgkfvgzgxkkwnevzfhxvjwygggihexlnhkgmnmlii{hevvfivxwyw{fznvnkkjmylzhw{z{jmmymwxfzxv{fijzwljixhkixhzwjgvf{{zzeigijmy{emhgfxwwfemhmyexvl{geikmkmjenhyynngizyjg{fnw{nggfexhzymlizfvjewjheikwl{xvj{jizzvznfvxjx{fkvwvyikjxxlzwigfghzwymyfgmjegzwynwjmhkezwhm{{yhvjylw{jz{lmfgmvwvwkkjeexeeexke{ehggxyhxyhzzf{wxhfkfmznjm{ezjhgeege{mfgkkzjxnx{zlxlzhzhynhzvhxn{gimegjikmkm{mzhjmw{gkzzfk{hjmjex{mhvfiimhjxjxwjyyfvigzxv{{fmyjivwvyxyjvexfzy{hxnjeeikn{jezlyjeghe{gwlwfjmzyjkxy{g{x{gw{ekznjvzjyjfiigvlemvfxjwljeemnwnhmnwl{nzvzzkeemnjjijv{ykgxjgzx{jkyn{nxlv{{fjmnnzhvligggfemhjm{f{wje{kgemhjzvlgxekn{vnhefeki{{v{ginfizix{g{ywygkzxegnjimgkzhzh{lnlfgyh{mfkznjvmffxmlhkzfjgjvzfyyznheyn{hkgn{w{xnz{jigvjiwhkmmhhgx{xlyyexeiiv{y{yhiienyhmvywjfvmjgkwyixx{emyfmnnnfmhkzwv{zwhgvwhkvjzhjz{geigzmnywigjiy{jxx{zwhkwhxjm{igjmvnxffifzkehghkmymlwl{i{ehgwwnh{xiiggyywn{fikhvwfmlzymjkex{vn{vmnnhyjmwvlxhz{{mwhmnie{mhgmj{hwnhz{jx{v{he{fieezmf{hm{yymwxhznjgxlnfyjfknj{kvjjeegxn{zvjyf{hji{{{{xjkiezvfzyhiegjmxjmhki{fzfkejzxnjewjgm{iimz{zy{keekkvfnn{vzzxhnlwfm{gghmgiynwjwhn{eigxyy{jmnmfnf{ynw{{hkjmevfgvykixy{jevnwylfefvggyjzlnyjeekzn{inlfgy{ylfvwnnhgeeizfhknjiewjvnmfvygzjiemmjxfywxhhxzljzwyhzgxkeev{ggvigmy{imymynnevjghxnjhi{g{w{yznmnznvwxyhmyygejxy{xnnhmlfgkijm{fm{vwyjmymfyhvwzxgg{lkmhmjiyfxjwnv{jkyhfevf{zzf{ifknjnwnlizzygikmgzkmz{egwwnjgxwnwjgewj{wml{xgzjeyf{him{jzvfinhfzzfizikw{jeiikiizvyvjkgjimn{wkkz{zvfgemvh{wxlvfki{ygm{zfkeifxhivlhxfeggfinjywggfkzfeiwjmfmy{xfz{jv{exzwgxmnjeji{njz{figggjzkizx{xxfggz{jv{nkgmf{g{hgzmjfkfkgixyzhxhigkifvimgeievwxjhzyj{{gvwyvj{mzjjxjewjznmjzveeyfvfwyfm{nggkmxjvwvjimigv{hmynjgn{xln{zfexyjylzx{xgxjmfzhxfzjghx{ymy{e{nml{fizjznjjim{ynnnhxwhix{jiggvexivzvfkggmjzl{fxhvyn{vheev{mwywyngvnlmhhkgvheekmlfmwwvhvnzvzv{fwlzwfefvxl{nfvgkkewy{fhmkimykmeizjywwlgzywgxwjee{xxjji{fexwjjmxlgzzjgkv{jxvyvfnyzxemfkxnkixwkmxj{yyjhxkkginlgifkyfgmw{kejxhzvjxnyhhm{nhenjiigxm{ywfmzvmjfimwzjzvwn{gjmhvzynfexjmkgjeevxhvynyfegegmjgzvvfegnhfihvjxiekkhxmjjmn{xnei{hv{nlzhyygvwjmhivieegfxxwwyylw{yyie{ihgxnvnxhfezfhm{eezeeznwlvjywjmz{y{xf{zig{hnjnh{mnygmjinn{{mh{fzhzfwyjgiv{{hiie{z{xznzhmfzwz{nl{m{mhzxh{wexnhfgyh{{mwjm{jzxhkjxggvfnwfxw{{veivnzzhgynzxzjv{exxyhgezfiw{yj{nkgggfm{fzh{gjifzhewjwwhvz{vj{z{hgxizxhzyekvwzlznv{y{xfz{imemivizm{{lfzgimjyymn{mnl{{xfivz{ieevhmjevhemzjzh{wxwzxhky{hkexexn{yhfxzlnnzwxhfm{evhzzeemyzzwnjxjeml{yjxkekkgegenlvyx{yjwlzv{mnhn{feekzj{wxhwj{jeehvxl{vzyfzmffmwh{xmyiky{jiwlwjmhkehky{zygiwlkenj{jjmnh{xvfzjiifiivnhnjwjx{ywevfgemfmz{y{hzivgigxjm{xxjhxke{hkifixlginyig{ehkegfmxhhzwwnfxyywizyl{{gxfggzkezlikzfvnwjmyimgzhvixigx{zwnhmw{ivn{wzzwnhgynzynheifxzzvyx{yjmfgemwievfikevhggew{{vjggezw{fzvfkxjzjxwfx{ife{iwjhijxhgw{fkexkggezxyl{{fxjvvjevekxwiiv{ggzhz{kehefvnykkvjw{zz{wfiw{{hnwwnyf{yww{zmf{wvjwyzlgvkixjkivhznzlzvfkigjxxn{nzjzwmfwwxwzlgeekevgimn{lzfwlixfikkxfggegwnfgjivfxw{fxwzykmgijvfzegw{nwywnljm{igkgkhgnnizwhwyjgzvhihgn{y{eznwhewwywhkvlnnhzjx{wkmhmgekgnyzxfvfemw{gzzmyyyjzwh{z{vmyzyzxeevwee{iivnyeezvhihmigfgylexmheigxjghzvnfvnnxwnlmlyfjmhiwywnynzyvyigxykgggmhjvmjkmeeegwlzjz{fzgmgmvn{hz{geyhzjjmjxxhv{exegznjvjmhz{ggizxmlzxwjmnfvyhwlxhv{fmxhjizyyy{wkinhmwgevw{gixgxfieizyjxyhgmjenn{wjiz{gmxniznfjmzvjzzlvhjxzwgkgzwnimzhfmwjxfjgmlfgzvfm{gzn{{hgegkgvl{yx{kkzjfx{{zxhk{iginnixzjezfeigfmxfmfvyjkvwhgvjnnyyxhvfkemlhmfiynmjkmynevwwvhmwhvzwhm{iylmhx{zn{l{xfxjvkgekvnjegxfxeeggjm{whv{f{fxfjgwhznjgeiexxl{ggg{y{xjxhifiix{jeejgml{z{veemhhm{yynkgzwwyy{exxfjgjz{yeknjv{hxynkm{lfxhimlemznmh{ifz{yxyeivyfekkx{vjjxwjvhhzxw{xezzwezwngzyn{{wfgk{{{nmyxy{ijmkgnwzjkikemn{hmhhxgm{ghmjeivjiwjz{kg{wkigmvnfzgefvxjigwffxylgkmfjzzygxevzywlfknjww{f{nzvgkwnezyl{xhexjexynxhzzikyhkievvwzwx{myxnxlyjv{v{znnj{wxy{n{g{nfmwwiiixhkwwki{fkekmjxhvfejmz{{hmyywmfxy{yezezwwxnezmlik{jhzimkg{hyyxwzl{livevemnnxwyfmlzwvf{mvjxj{megfvwnxyxhkmjvex{feiznzwfe{imhgz{wm{ixgm{ljghvvn{mnywnjkkkjxnnhxjkxwgzy{wwyhzjzx{ngxwn{{kgvj{mjmjmjejejmhizvx{ikmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgmvjeegvkmgzkmz{gezj{gv{evfzwfkk{{xyfkxh{iywyf{xwyfe{yzxfzfxvfwlgvxlhzzjgmkewfvn{gmfhkevjkmfgmmngigzkghvjievzzxlkggghi{xnwznjeznfenj{{ig{yhvvhjzhzgenjvhzxvjvyemjejxegnffeyf{yzzemixnwggzx{z{hjzvl{xgigigxjeigwn{zyfwj{xywhgjekkeviefxnhmnvjzhyjzy{zexgmhxn{ivvy{iwlywmhiemynwfxkkxfzz{wy{nyzlhmjkznki{kwfjx{lzn{gjm{xnwheiijifggkxyevn{{h{myyjvzy{injzj{j{zxnhvxyn{hxjmyhgezhzwkkwfwlnnkgegjxynyfjzwyhkjggifg{wyn{ywnwnkevj{yn{zhfk{ggexfmlnl{wvwvwvf{wzlwhegxlzyylevwhfxfmhigxggnlfmxhjvmnzlxwznzl{{vjjmzlz{zvikxl{ekgnjgefvnynl{gm{xw{xnliikgxlz{kiznnfxyzzgikkn{exgiizevwhy{kifmvfmnnnjgnfjixhevexginjylevnw{ejzzn{xvfhe{efigknweemwkkjmvjzjvjixzl{hxyezfiwfwhemxfmnhmkkfgxnei{hnhmfxynykgxyfixn{hmjxjhmemylw{hxxnjgw{hgmlxhixwhhigzwjwnxyjihxzly{zzzhx{gexlznjmgixfgzivvn{zevjghxywjznh{nkkmnxhxw{z{hznzhgimywfhekehihzxhkgnyfzxjjmjegvhvhiwywn{lgmeimnjzwy{v{exnzzyffzeeii{v{f{igmgm{kee{y{nwhkivywfhe{gjgeghvmlnnyfhgfkixnhkkx{yjzlxnfvn{jimwxhgvgekgz{kinhwhfx{kekkkivwjznzxfi{xjixj{yyj{wxh{vivzzvhz{gmmhxyxjjvvfxwgxgejkkkwwxhhv{vv{gxekekvwkmywjkegv{wlekixn{wwvnei{jyw{{vnnjzym{{emfkmggkemlvyhkzfjxzhnhjxkkfx{fei{hnhggynmngvxhnl{jynmlkghm{i{fmfjz{ljgw{{lvn{mgkgkywhgmjhmfkxhjm{egkzzzhzn{gjgjvhvmhjeie{xvnxfmnyl{{ywjznhzyxhiz{e{jixzlznmfjzie{ngvfey{vfexgznyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxyjeghe{gyleghvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkihmxjkkwwxhjg{vwwgxekginjkmywjkegnfyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhjigvwjmhxn{hjxxjhm{iylw{jz{ljgw{hgml{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgi{wjinlnfjkmnjghxzhjznhzykkmnzj{j{z{hznzhmfzwhekm{mzhhzxhgzfvfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxiiwfylfzgmgm{kzfxfn{gzzyyjeghe{gylfehvnhnnyfjm{xixnhkkx{{v{lfg{gzlxhfzxhgvxfkg{wkinhnj{k{kekkkiv{gm{{j{xjixhkmkgyjhxxhzziv{hmjyfgmkmxyxjxym{himh{nxjkkwwxhhxvwfezhw{nhkeylywjkegggyfzwiizlem{zmhzxgi{{njjzeim{{emfkmxyhvnh{zyfee{lzl{ejxxhn{jxwh{hnhggzhxhkiwjmhxnxnxnigz{vn{{eviiekjgw{hgwn{nzzgzjxgkekwnxyxhhxzlxwzzzhzn{gxlznjmgihxjinlnfhv{vjghxzhjzv{zykkmnzjyhjgz{znzhmfzwgkxlkgm{fm{yyynyfzyfjmjejejmhiwywn{lmjfzkmhkxjwn{exngiyffzzxii{vylfzgmgm{keexfn{gzgxjizhhe{gjkwfhvnhnnyfjm{xixnhkkx{znxngm{gzlxhmwxhgvxfkg{wkinhnj{k{kekkkivwjm{{j{xjixhxj{yyjhxxhzzivzzmjyfgmmhxyxjxym{gkkijzxjkkwwxhjgfgwwgxekzzixkmywjkegnffezwiizlem{zmhzxgi{{fkmh{njm{emfkmizz{wn{zyfee{lywgmjxxhn{xnei{hnhggzhji{{xyjzxn{h{kxjkewjvhywhmzvjgw{hgw{yw{fzyjxgkek{ewwwnzwikfefi{mzn{gxlyjjmnh{wjinlggjkmnjghxzhxwnhzykkgezj{j{zm{{gzhmfzw{fgv{mzhhzkkzfnyfzzyjmiiynmnjxwy{emf{{{mxjvfgmhk{xgmmjkgfz{jii{vylfzgmnl{kvyxfn{gzkkyjeghe{gzweghvv{fvyfjmvyxnnhxljeznkegm{gywxhwlighzkk{xzxkifiwynjjxgmyjmwzfkg{j{xjizjfx{yyjhxexwwimzjwnjkgmfgxyxjxym{gkkihmxjkkwwxhyhjiimkkezn{njyyywylfzfzyfhzzfgxem{zmhzxgi{{njjzeim{{ezliefv{ihkfmvlix{i{{nfeekgkgievynjjgx{kkgvwyfgevv{ynynvfii{zz{vw{xy{njiivhkiixw{ighi{ekgzxfiyyzwmfzh{y{eekvliihi{gzx{v{mivmjxwge{mkiemnfzlgxzffimhxyzfnlhxzzemxjev{evhkkkmgmyngmhxznmjzxiknhjznfy{yjfiyfmwyhjmxjz{hzynwjm{zjxjvlwfhieknw{wzwikvjexkievkk{yz{hgevfxwwizfzmjggki{iixfz{givgm{gzljimwxhkmxfx{{wnhwnfgvw{zjvzxiiekzwgxvnheznzh{ijiwfgmvhy{zl{{{h{e{jwhjegekghegviifezvhvkkekvlegimjixfv{zzwnnl{hnffe{vxjmw{lfvwywwnlhenjhmmhwlkkekxnvnz{mj{mv{vnixjvgmjxxhn{hkwjxwnhggzhieynwjmhxnimjxjkvwwjylimxnzvjgw{hgml{nzzgzjxgkek{ez{w{hx{xjvzzzhgvwlzfznjmgiyhhmnlnfxjmnjghxzhjznhzykkfekmeejxxwekxfzwyffiynjgxw{wfewfivfm{{xhmfkkjzznikegjm{nm{xlfvgvzxekyhnhfv{keziv{f{{imzvvwnfvfz{wn{nggfkgky{znhm{nkg{{gmwyxhvnn{izzhjvx{ezeezynhkknlwy{wwnzjyhml{nmnjmnhnnmwem{vvlekwjxwznwwjg{wvjfg{xyww{izfkhx{lv{vhjvevgkyhjgkmiggvjzkefgnnynvlemfvgzfx{jw{jkjkhkwlnn{jkgznjix{eeixz{vyegixnl{wwjmyhvjgvj{m{vgkiknlex{ejiixeg{fwykm{kvnfififi{gyjjifgvjwj{xzv{x{inwvjkijen{evhivlvfhmezfg{{m{zljv{jn{fefknhz{y{hzzx{kfeegfm{xfv{njinhmnhzzh{hikzxzn{{m{ememhvzxvnzvgm{nywgmevvygv{{m{yngevhhxikjeynnjxnwyiiekkmxlwwfgkkwnjggvnnevzxjkwwy{mffgezhz{hy{jvvwvlgew{mlgk{fzwhgfkzhywyhhxexnyemvj{jfexjvfylyyjkjx{izwjmwhnnkefiwljmkiekggfgzvex&$%@*&$%@*1&$%@*&$%@*&$%@*U
Ef0EBG0E
0EDA3*
Cjjj0n
],rj&$%@*&$%@*U
],vjjjjjjj
jjjjjjj